BLASTX nr result
ID: Ophiopogon26_contig00034107
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00034107 (364 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_009429017.1| hypothetical protein (chloroplast) [Alpinia ... 49 8e-10 >ref|YP_009429017.1| hypothetical protein (chloroplast) [Alpinia oxyphylla] gb|ASW20479.1| hypothetical protein (chloroplast) [Alpinia oxyphylla] Length = 138 Score = 49.3 bits (116), Expect(2) = 8e-10 Identities = 26/34 (76%), Positives = 26/34 (76%) Frame = +2 Query: 2 IHRPYILESSIIDIFVLSFYHLSIYPHPFIFFLQ 103 IHRPYILES II IFVLSF H SIY H FIF Q Sbjct: 59 IHRPYILESYIIYIFVLSFSHPSIYLHLFIFASQ 92 Score = 41.6 bits (96), Expect(2) = 8e-10 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = +1 Query: 139 SCYNYMIDSVIQSYSDCFLGSRQYEVIS 222 SC NYMID I SYSDCFLG R YE IS Sbjct: 112 SCCNYMIDPPI-SYSDCFLGYRYYEAIS 138