BLASTX nr result
ID: Ophiopogon26_contig00033987
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00033987 (432 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK81080.1| uncharacterized protein A4U43_C01F25000 [Asparagu... 90 2e-18 ref|XP_020268045.1| uncharacterized protein LOC109843517 [Aspara... 67 4e-11 gb|ESR55417.1| hypothetical protein CICLE_v10023350mg, partial [... 55 2e-06 ref|XP_015385608.1| PREDICTED: uncharacterized protein LOC102622... 55 5e-06 dbj|GAY62196.1| hypothetical protein CUMW_215860 [Citrus unshiu] 55 8e-06 >gb|ONK81080.1| uncharacterized protein A4U43_C01F25000 [Asparagus officinalis] Length = 361 Score = 89.7 bits (221), Expect = 2e-18 Identities = 38/49 (77%), Positives = 45/49 (91%) Frame = +1 Query: 283 RFPGNEFDIKAQHLPLMSYWTEKRCASREHFENLFGRADNKMYHELAKK 429 RFPGN+FD A+ LP+M++WTEKRCASRE++ENLFGRADNKMYHEL KK Sbjct: 122 RFPGNDFDYNAKSLPIMAHWTEKRCASRENYENLFGRADNKMYHELQKK 170 >ref|XP_020268045.1| uncharacterized protein LOC109843517 [Asparagus officinalis] ref|XP_020268053.1| uncharacterized protein LOC109843517 [Asparagus officinalis] Length = 144 Score = 66.6 bits (161), Expect = 4e-11 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +1 Query: 331 MSYWTEKRCASREHFENLFGRADNKMYHELAKK 429 M++WTEKRCASRE++ENLFGRADNKMYHEL KK Sbjct: 1 MAHWTEKRCASRENYENLFGRADNKMYHELQKK 33 >gb|ESR55417.1| hypothetical protein CICLE_v10023350mg, partial [Citrus clementina] Length = 168 Score = 54.7 bits (130), Expect = 2e-06 Identities = 24/57 (42%), Positives = 33/57 (57%) Frame = +1 Query: 22 YIPHYYLNILTDMEKISSLNWARFTLDFLFSSIERQKRKNTKYVSGCMLLLQVILTH 192 YI H +L+ D+ + SLNWA F +L SI + K + T YV GC+L LQ+ H Sbjct: 71 YISHLFLHPCNDVLNVKSLNWASFCYKWLAKSIGKYKNRETTYVGGCLLFLQIFYLH 127 >ref|XP_015385608.1| PREDICTED: uncharacterized protein LOC102622365 [Citrus sinensis] Length = 233 Score = 54.7 bits (130), Expect = 5e-06 Identities = 24/57 (42%), Positives = 33/57 (57%) Frame = +1 Query: 22 YIPHYYLNILTDMEKISSLNWARFTLDFLFSSIERQKRKNTKYVSGCMLLLQVILTH 192 YI H +L+ D+ + SLNWA F +L SI + K + T YV GC+L LQ+ H Sbjct: 71 YISHLFLHPCNDVLNVKSLNWASFCYKWLAKSIGKYKNRETTYVGGCLLFLQIFYLH 127 >dbj|GAY62196.1| hypothetical protein CUMW_215860 [Citrus unshiu] Length = 417 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/57 (42%), Positives = 33/57 (57%) Frame = +1 Query: 22 YIPHYYLNILTDMEKISSLNWARFTLDFLFSSIERQKRKNTKYVSGCMLLLQVILTH 192 YI H +L+ D+ + SLNWA F +L SI + K + T YV GC+L LQ+ H Sbjct: 71 YISHLFLHPCNDVLNVKSLNWASFCYKWLAKSIGKYKNRETTYVGGCLLFLQIFYLH 127