BLASTX nr result
ID: Ophiopogon26_contig00033867
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00033867 (386 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020249584.1| serine/threonine-protein phosphatase PP1(5.9... 65 2e-10 ref|XP_020866770.1| importin subunit alpha-2 [Arabidopsis lyrata... 65 2e-10 gb|EFH67598.1| hypothetical protein ARALYDRAFT_891491 [Arabidops... 65 1e-09 ref|XP_020274496.1| importin subunit alpha-1a-like [Asparagus of... 63 1e-09 ref|XP_024190102.1| importin subunit alpha-1a-like, partial [Ros... 64 1e-09 ref|XP_016175970.1| importin subunit alpha-1a, partial [Arachis ... 65 1e-09 gb|ONK67567.1| uncharacterized protein A4U43_C05F1380 [Asparagus... 65 2e-09 ref|XP_010548966.1| PREDICTED: importin subunit alpha-2-like [Ta... 65 2e-09 ref|XP_020254907.1| importin subunit alpha-2-like [Asparagus off... 65 2e-09 ref|XP_020273437.1| importin subunit alpha-1a-like [Asparagus of... 65 2e-09 gb|OVA02574.1| Armadillo [Macleaya cordata] 65 2e-09 ref|XP_016175571.1| importin subunit alpha-2 [Arachis ipaensis] ... 65 2e-09 ref|XP_015939734.1| importin subunit alpha-2 [Arachis duranensis] 65 2e-09 ref|XP_015939733.1| importin subunit alpha-2 [Arachis duranensis... 65 2e-09 ref|XP_015939720.1| importin subunit alpha-2 [Arachis duranensis... 65 2e-09 ref|XP_010551087.1| PREDICTED: importin subunit alpha-2 [Tarenay... 65 2e-09 gb|ONK80722.1| uncharacterized protein A4U43_C01F21010 [Asparagu... 64 2e-09 ref|XP_011082432.1| importin subunit alpha [Sesamum indicum] 64 2e-09 ref|XP_006414387.1| importin subunit alpha-2 [Eutrema salsugineu... 64 2e-09 gb|PKA58395.1| Importin subunit alpha-1 [Apostasia shenzhenica] 64 2e-09 >ref|XP_020249584.1| serine/threonine-protein phosphatase PP1(5.9)-like [Asparagus officinalis] Length = 187 Score = 65.5 bits (158), Expect = 2e-10 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 385 WALTNIANVTSENTKAGIDHGAVPIFVRLLVSQSGDVREHVL 260 WALTNIA+ TSENTK IDHGAVPIFVRLL S S DVRE ++ Sbjct: 137 WALTNIASGTSENTKVVIDHGAVPIFVRLLASPSDDVREQLM 178 >ref|XP_020866770.1| importin subunit alpha-2 [Arabidopsis lyrata subsp. lyrata] Length = 170 Score = 64.7 bits (156), Expect = 2e-10 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = -2 Query: 385 WALTNIANVTSENTKAGIDHGAVPIFVRLLVSQSGDVREHVL 260 WALTNIA+ TSENTK I+HGAVPIFV+LL SQS DVRE ++ Sbjct: 62 WALTNIASGTSENTKVVIEHGAVPIFVQLLASQSDDVREQLI 103 >gb|EFH67598.1| hypothetical protein ARALYDRAFT_891491 [Arabidopsis lyrata subsp. lyrata] Length = 283 Score = 64.7 bits (156), Expect = 1e-09 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = -2 Query: 385 WALTNIANVTSENTKAGIDHGAVPIFVRLLVSQSGDVREHVL 260 WALTNIA+ TSENTK I+HGAVPIFV+LL SQS DVRE ++ Sbjct: 175 WALTNIASGTSENTKVVIEHGAVPIFVQLLASQSDDVREQLI 216 >ref|XP_020274496.1| importin subunit alpha-1a-like [Asparagus officinalis] ref|XP_020274497.1| importin subunit alpha-1a-like [Asparagus officinalis] ref|XP_020274498.1| importin subunit alpha-1a-like [Asparagus officinalis] ref|XP_020274499.1| importin subunit alpha-1a-like [Asparagus officinalis] gb|ONK63037.1| uncharacterized protein A4U43_C07F10740 [Asparagus officinalis] Length = 156 Score = 62.8 bits (151), Expect = 1e-09 Identities = 31/42 (73%), Positives = 34/42 (80%) Frame = -2 Query: 385 WALTNIANVTSENTKAGIDHGAVPIFVRLLVSQSGDVREHVL 260 WALTNIA+ TSENTK IDH AVPIFVRLL S S DVRE ++ Sbjct: 106 WALTNIASGTSENTKVVIDHDAVPIFVRLLASPSDDVREQLM 147 >ref|XP_024190102.1| importin subunit alpha-1a-like, partial [Rosa chinensis] Length = 257 Score = 64.3 bits (155), Expect = 1e-09 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = -2 Query: 385 WALTNIANVTSENTKAGIDHGAVPIFVRLLVSQSGDVREHVL 260 WALTNIA+ TSENTK I+HGAVPIFV+LL S S DVREH + Sbjct: 84 WALTNIASGTSENTKVVIEHGAVPIFVKLLSSPSDDVREHAV 125 >ref|XP_016175970.1| importin subunit alpha-1a, partial [Arachis ipaensis] Length = 403 Score = 64.7 bits (156), Expect = 1e-09 Identities = 32/42 (76%), Positives = 34/42 (80%) Frame = -2 Query: 385 WALTNIANVTSENTKAGIDHGAVPIFVRLLVSQSGDVREHVL 260 WALTNIA+ TSENTK IDHGAVPIFVRLL S S DVRE + Sbjct: 140 WALTNIASGTSENTKVVIDHGAVPIFVRLLASPSDDVREQAV 181 >gb|ONK67567.1| uncharacterized protein A4U43_C05F1380 [Asparagus officinalis] Length = 486 Score = 64.7 bits (156), Expect = 2e-09 Identities = 32/42 (76%), Positives = 34/42 (80%) Frame = -2 Query: 385 WALTNIANVTSENTKAGIDHGAVPIFVRLLVSQSGDVREHVL 260 WALTNIA+ TSENTK IDHGAVPIFVRLL S S DVRE + Sbjct: 138 WALTNIASGTSENTKVVIDHGAVPIFVRLLASPSDDVREQAV 179 >ref|XP_010548966.1| PREDICTED: importin subunit alpha-2-like [Tarenaya hassleriana] Length = 524 Score = 64.7 bits (156), Expect = 2e-09 Identities = 32/42 (76%), Positives = 34/42 (80%) Frame = -2 Query: 385 WALTNIANVTSENTKAGIDHGAVPIFVRLLVSQSGDVREHVL 260 WALTNIA+ TSENTK IDHGAVPIFVRLL S S DVRE + Sbjct: 137 WALTNIASGTSENTKVVIDHGAVPIFVRLLASPSDDVREQAV 178 >ref|XP_020254907.1| importin subunit alpha-2-like [Asparagus officinalis] ref|XP_020254908.1| importin subunit alpha-2-like [Asparagus officinalis] Length = 529 Score = 64.7 bits (156), Expect = 2e-09 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 385 WALTNIANVTSENTKAGIDHGAVPIFVRLLVSQSGDVREHVL 260 WALTNIA+ TSENTK IDHGAVPIFV+LL SQS DVRE + Sbjct: 138 WALTNIASGTSENTKVVIDHGAVPIFVKLLGSQSDDVREQAV 179 >ref|XP_020273437.1| importin subunit alpha-1a-like [Asparagus officinalis] gb|ONK63310.1| uncharacterized protein A4U43_C07F13690 [Asparagus officinalis] Length = 529 Score = 64.7 bits (156), Expect = 2e-09 Identities = 32/42 (76%), Positives = 34/42 (80%) Frame = -2 Query: 385 WALTNIANVTSENTKAGIDHGAVPIFVRLLVSQSGDVREHVL 260 WALTNIA+ TSENTK IDHGAVPIFVRLL S S DVRE + Sbjct: 138 WALTNIASGTSENTKVVIDHGAVPIFVRLLASPSDDVREQAV 179 >gb|OVA02574.1| Armadillo [Macleaya cordata] Length = 530 Score = 64.7 bits (156), Expect = 2e-09 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 385 WALTNIANVTSENTKAGIDHGAVPIFVRLLVSQSGDVREHVL 260 WALTNIA+ TSENTK IDHGAVPIFV+LL SQS DVRE + Sbjct: 138 WALTNIASGTSENTKVVIDHGAVPIFVKLLGSQSDDVREQAV 179 >ref|XP_016175571.1| importin subunit alpha-2 [Arachis ipaensis] ref|XP_020968235.1| importin subunit alpha-2 [Arachis ipaensis] Length = 531 Score = 64.7 bits (156), Expect = 2e-09 Identities = 32/42 (76%), Positives = 34/42 (80%) Frame = -2 Query: 385 WALTNIANVTSENTKAGIDHGAVPIFVRLLVSQSGDVREHVL 260 WALTNIA+ TSENTK IDHGAVPIFVRLL S S DVRE + Sbjct: 140 WALTNIASGTSENTKVVIDHGAVPIFVRLLASPSDDVREQAV 181 >ref|XP_015939734.1| importin subunit alpha-2 [Arachis duranensis] Length = 531 Score = 64.7 bits (156), Expect = 2e-09 Identities = 32/42 (76%), Positives = 34/42 (80%) Frame = -2 Query: 385 WALTNIANVTSENTKAGIDHGAVPIFVRLLVSQSGDVREHVL 260 WALTNIA+ TSENTK IDHGAVPIFVRLL S S DVRE + Sbjct: 140 WALTNIASGTSENTKVVIDHGAVPIFVRLLASPSDDVREQAV 181 >ref|XP_015939733.1| importin subunit alpha-2 [Arachis duranensis] ref|XP_020987787.1| importin subunit alpha-2 [Arachis duranensis] ref|XP_020987788.1| importin subunit alpha-2 [Arachis duranensis] Length = 531 Score = 64.7 bits (156), Expect = 2e-09 Identities = 32/42 (76%), Positives = 34/42 (80%) Frame = -2 Query: 385 WALTNIANVTSENTKAGIDHGAVPIFVRLLVSQSGDVREHVL 260 WALTNIA+ TSENTK IDHGAVPIFVRLL S S DVRE + Sbjct: 140 WALTNIASGTSENTKVVIDHGAVPIFVRLLASPSDDVREQAV 181 >ref|XP_015939720.1| importin subunit alpha-2 [Arachis duranensis] ref|XP_020987953.1| importin subunit alpha-2 [Arachis duranensis] Length = 531 Score = 64.7 bits (156), Expect = 2e-09 Identities = 32/42 (76%), Positives = 34/42 (80%) Frame = -2 Query: 385 WALTNIANVTSENTKAGIDHGAVPIFVRLLVSQSGDVREHVL 260 WALTNIA+ TSENTK IDHGAVPIFVRLL S S DVRE + Sbjct: 140 WALTNIASGTSENTKVVIDHGAVPIFVRLLASPSDDVREQAV 181 >ref|XP_010551087.1| PREDICTED: importin subunit alpha-2 [Tarenaya hassleriana] ref|XP_010551088.1| PREDICTED: importin subunit alpha-2 [Tarenaya hassleriana] Length = 534 Score = 64.7 bits (156), Expect = 2e-09 Identities = 32/42 (76%), Positives = 34/42 (80%) Frame = -2 Query: 385 WALTNIANVTSENTKAGIDHGAVPIFVRLLVSQSGDVREHVL 260 WALTNIA+ TSENTK IDHGAVPIFVRLL S S DVRE + Sbjct: 143 WALTNIASGTSENTKVVIDHGAVPIFVRLLASPSDDVREQAV 184 >gb|ONK80722.1| uncharacterized protein A4U43_C01F21010 [Asparagus officinalis] Length = 347 Score = 64.3 bits (155), Expect = 2e-09 Identities = 32/39 (82%), Positives = 33/39 (84%) Frame = -2 Query: 385 WALTNIANVTSENTKAGIDHGAVPIFVRLLVSQSGDVRE 269 WALTNIA+ TSENTK IDHGAVPIFVRLL S S DVRE Sbjct: 235 WALTNIASGTSENTKVVIDHGAVPIFVRLLASPSDDVRE 273 >ref|XP_011082432.1| importin subunit alpha [Sesamum indicum] Length = 529 Score = 64.3 bits (155), Expect = 2e-09 Identities = 32/42 (76%), Positives = 34/42 (80%) Frame = -2 Query: 385 WALTNIANVTSENTKAGIDHGAVPIFVRLLVSQSGDVREHVL 260 WALTNIA+ TSENTK IDHGAVPIFVRLL S S DVRE + Sbjct: 138 WALTNIASGTSENTKVVIDHGAVPIFVRLLSSSSDDVREQAV 179 >ref|XP_006414387.1| importin subunit alpha-2 [Eutrema salsugineum] gb|ESQ55840.1| hypothetical protein EUTSA_v10024884mg [Eutrema salsugineum] Length = 534 Score = 64.3 bits (155), Expect = 2e-09 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = -2 Query: 385 WALTNIANVTSENTKAGIDHGAVPIFVRLLVSQSGDVREHVL 260 WALTNIA+ TSENTK I+HGAVPIFV+LL SQS DVRE + Sbjct: 143 WALTNIASGTSENTKVVIEHGAVPIFVKLLASQSDDVREQAV 184 >gb|PKA58395.1| Importin subunit alpha-1 [Apostasia shenzhenica] Length = 554 Score = 64.3 bits (155), Expect = 2e-09 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = -2 Query: 385 WALTNIANVTSENTKAGIDHGAVPIFVRLLVSQSGDVREHVL 260 WALTNIA+ TSENTK IDHGAVPIFV+LL S+S DVRE + Sbjct: 162 WALTNIASGTSENTKVVIDHGAVPIFVKLLASRSDDVREQAV 203