BLASTX nr result
ID: Ophiopogon26_contig00033821
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00033821 (411 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC15216.1| hypothetical protein RIR_0362000 [Rhizophagus ir... 109 6e-29 >dbj|GBC15216.1| hypothetical protein RIR_0362000 [Rhizophagus irregularis DAOM 181602] Length = 70 Score = 109 bits (273), Expect = 6e-29 Identities = 51/52 (98%), Positives = 51/52 (98%) Frame = +3 Query: 36 FHFFSRNYFLVMNYIDIARNLFGASDGHIKRCNKIIGKILESLDDYQPKRDK 191 FHF SRNYFLVMNYIDIARNLFGASDGHIKRCNKIIGKILESLDDYQPKRDK Sbjct: 19 FHFLSRNYFLVMNYIDIARNLFGASDGHIKRCNKIIGKILESLDDYQPKRDK 70