BLASTX nr result
ID: Ophiopogon26_contig00033811
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00033811 (421 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020273911.1| uncharacterized protein LOC109848689 [Aspara... 67 5e-10 >ref|XP_020273911.1| uncharacterized protein LOC109848689 [Asparagus officinalis] gb|ONK62380.1| uncharacterized protein A4U43_C07F3280 [Asparagus officinalis] Length = 1306 Score = 66.6 bits (161), Expect = 5e-10 Identities = 29/58 (50%), Positives = 40/58 (68%) Frame = +3 Query: 135 LSNVPPSLGHNDARVSLDLELKPPCRPEPRFNWLDIGPGKKDSDVEIIDLSLSLASSC 308 L+ +PP N +++ LDLELK PC P+P FNWL P K++D E++DLSLSL +C Sbjct: 51 LAKLPPPTSQNVSQIDLDLELKLPCGPQPSFNWLFNDPDDKNTDEEMVDLSLSLVGNC 108