BLASTX nr result
ID: Ophiopogon26_contig00033772
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00033772 (421 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008246349.1| PREDICTED: pentatricopeptide repeat-containi... 58 4e-07 ref|XP_021830415.1| pentatricopeptide repeat-containing protein ... 57 7e-07 ref|XP_008370323.1| PREDICTED: pentatricopeptide repeat-containi... 57 1e-06 gb|KHN17841.1| Pentatricopeptide repeat-containing protein [Glyc... 57 1e-06 ref|XP_003555763.1| PREDICTED: pentatricopeptide repeat-containi... 57 1e-06 ref|XP_006289785.1| pentatricopeptide repeat-containing protein ... 56 2e-06 ref|XP_003591286.1| ribosomal protein L15 [Medicago truncatula] ... 56 2e-06 ref|XP_009365994.1| PREDICTED: pentatricopeptide repeat-containi... 55 3e-06 ref|XP_010037982.1| PREDICTED: pentatricopeptide repeat-containi... 55 6e-06 ref|XP_009337852.1| PREDICTED: pentatricopeptide repeat-containi... 54 8e-06 >ref|XP_008246349.1| PREDICTED: pentatricopeptide repeat-containing protein At4g38150-like [Prunus mume] Length = 323 Score = 58.2 bits (139), Expect = 4e-07 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -2 Query: 420 EMKGKGFVPDEAAVRESLASKGGPMLRSVVGLLFGK 313 EMKGKGFVPDE AVRE L SK GP++RSV+ +LFGK Sbjct: 288 EMKGKGFVPDEKAVREVLKSKRGPVVRSVINILFGK 323 >ref|XP_021830415.1| pentatricopeptide repeat-containing protein At4g38150-like [Prunus avium] Length = 324 Score = 57.4 bits (137), Expect = 7e-07 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -2 Query: 420 EMKGKGFVPDEAAVRESLASKGGPMLRSVVGLLFGK 313 EMKGKGFVPDE AVRE L SK GP++RSV +LFGK Sbjct: 289 EMKGKGFVPDEKAVREVLKSKRGPVIRSVTNILFGK 324 >ref|XP_008370323.1| PREDICTED: pentatricopeptide repeat-containing protein At4g38150-like [Malus domestica] Length = 331 Score = 57.0 bits (136), Expect = 1e-06 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = -2 Query: 420 EMKGKGFVPDEAAVRESLASKGGPMLRSVVGLLFGK 313 EMKGKGFVPDE AVRE L SK GP++R+V+ +LFGK Sbjct: 296 EMKGKGFVPDEKAVREVLKSKRGPVVRTVINILFGK 331 >gb|KHN17841.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 259 Score = 56.6 bits (135), Expect = 1e-06 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = -2 Query: 420 EMKGKGFVPDEAAVRESLASKGGPMLRSVVGLLFGK 313 +MKGKGFVPDE AVRE LASK GP+ R+V+ +LFGK Sbjct: 224 QMKGKGFVPDEKAVREVLASKRGPVFRNVIDVLFGK 259 >ref|XP_003555763.1| PREDICTED: pentatricopeptide repeat-containing protein At4g38150-like [Glycine max] gb|KRG90412.1| hypothetical protein GLYMA_20G089500 [Glycine max] Length = 289 Score = 56.6 bits (135), Expect = 1e-06 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = -2 Query: 420 EMKGKGFVPDEAAVRESLASKGGPMLRSVVGLLFGK 313 +MKGKGFVPDE AVRE LASK GP+ R+V+ +LFGK Sbjct: 254 QMKGKGFVPDEKAVREVLASKRGPVFRNVIDVLFGK 289 >ref|XP_006289785.1| pentatricopeptide repeat-containing protein At4g38150 isoform X1 [Capsella rubella] gb|EOA22683.1| hypothetical protein CARUB_v10003387mg [Capsella rubella] Length = 362 Score = 56.2 bits (134), Expect = 2e-06 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = -2 Query: 420 EMKGKGFVPDEAAVRESLASKGGPMLRSVVGLLFGK 313 EMKGKGFVPDE AVRE+L SK GP+ R+V+ LLF K Sbjct: 327 EMKGKGFVPDEKAVREALQSKRGPVFRTVINLLFNK 362 >ref|XP_003591286.1| ribosomal protein L15 [Medicago truncatula] gb|AES61537.1| ribosomal protein L15 [Medicago truncatula] Length = 276 Score = 55.8 bits (133), Expect = 2e-06 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = -2 Query: 420 EMKGKGFVPDEAAVRESLASKGGPMLRSVVGLLFGK 313 EMKGKGFVPDE AVRE L++K GP+ R+V+ +LFGK Sbjct: 241 EMKGKGFVPDENAVREVLSNKRGPVFRTVINILFGK 276 >ref|XP_009365994.1| PREDICTED: pentatricopeptide repeat-containing protein At4g38150-like [Pyrus x bretschneideri] Length = 331 Score = 55.5 bits (132), Expect = 3e-06 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -2 Query: 420 EMKGKGFVPDEAAVRESLASKGGPMLRSVVGLLFGK 313 EMKGKGF PDE AVRE L SK GP++R+V+ +LFGK Sbjct: 296 EMKGKGFAPDEKAVREVLKSKRGPIVRTVINILFGK 331 >ref|XP_010037982.1| PREDICTED: pentatricopeptide repeat-containing protein At4g38150 [Eucalyptus grandis] gb|KCW84523.1| hypothetical protein EUGRSUZ_B01359 [Eucalyptus grandis] Length = 321 Score = 54.7 bits (130), Expect = 6e-06 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = -2 Query: 417 MKGKGFVPDEAAVRESLASKGGPMLRSVVGLLFGK 313 MKG+GFVPDE AVRE++ SK GP+ RSV+ +LFGK Sbjct: 287 MKGRGFVPDEKAVREAIGSKRGPVFRSVMSILFGK 321 >ref|XP_009337852.1| PREDICTED: pentatricopeptide repeat-containing protein At4g38150-like [Pyrus x bretschneideri] Length = 331 Score = 54.3 bits (129), Expect = 8e-06 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = -2 Query: 420 EMKGKGFVPDEAAVRESLASKGGPMLRSVVGLLFGK 313 EMKGKGF+PDE A RE L SK GP++R+V+ +LFGK Sbjct: 296 EMKGKGFMPDEKAAREVLKSKRGPVVRTVINILFGK 331