BLASTX nr result
ID: Ophiopogon26_contig00033530
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00033530 (646 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020255613.1| uncharacterized protein LOC109832642 [Aspara... 94 6e-19 ref|XP_002454274.2| transcription termination factor MTERF2, chl... 92 4e-18 ref|XP_020244181.1| uncharacterized protein LOC109822395 [Aspara... 91 6e-18 dbj|BAJ91610.1| predicted protein [Hordeum vulgare subsp. vulgare] 91 6e-18 ref|XP_020081254.1| transcription termination factor MTERF2, chl... 91 1e-17 ref|XP_020093038.1| transcription termination factor MTERF2, chl... 91 1e-17 ref|XP_021304237.1| transcription termination factor MTERF15, mi... 90 2e-17 gb|ONK60890.1| uncharacterized protein A4U43_C08F23770 [Asparagu... 90 3e-17 gb|EMS50729.1| hypothetical protein TRIUR3_09354 [Triticum urartu] 85 5e-17 ref|XP_020152400.1| uncharacterized protein LOC109737686 [Aegilo... 89 5e-17 ref|XP_020191155.1| uncharacterized protein LOC109776900 [Aegilo... 88 7e-17 ref|XP_020179313.1| uncharacterized protein LOC109764942 [Aegilo... 88 7e-17 gb|PAN24918.1| hypothetical protein PAHAL_C00328 [Panicum hallii] 88 8e-17 gb|PAN24917.1| hypothetical protein PAHAL_C00328 [Panicum hallii] 88 9e-17 ref|XP_020185296.1| uncharacterized protein LOC109770991 [Aegilo... 88 1e-16 gb|OEL23928.1| hypothetical protein BAE44_0015051 [Dichanthelium... 87 1e-16 ref|NP_001132554.1| putative mitochondrial transcription termina... 87 1e-16 ref|XP_020575730.1| uncharacterized protein LOC110021537 isoform... 87 1e-16 ref|XP_020575729.1| uncharacterized protein LOC110021537 isoform... 87 2e-16 ref|XP_004965023.1| transcription termination factor MTERF8, chl... 87 2e-16 >ref|XP_020255613.1| uncharacterized protein LOC109832642 [Asparagus officinalis] ref|XP_020255614.1| uncharacterized protein LOC109832642 [Asparagus officinalis] ref|XP_020255615.1| uncharacterized protein LOC109832642 [Asparagus officinalis] ref|XP_020255616.1| uncharacterized protein LOC109832642 [Asparagus officinalis] gb|ONK73958.1| uncharacterized protein A4U43_C03F1340 [Asparagus officinalis] Length = 386 Score = 94.0 bits (232), Expect = 6e-19 Identities = 43/89 (48%), Positives = 65/89 (73%), Gaps = 1/89 (1%) Frame = +3 Query: 3 EFLVGRVGCDPSYVASRPLLLTLSLEKRLIPRHYVMDILRTNGIAAK-RNFYSIMCLPEK 179 EFLVG+ GC+ SY+ S P +L SLEKRL+PR +VM+IL+++ + + N Y+++CL EK Sbjct: 296 EFLVGKGGCENSYIVSHPSILGFSLEKRLMPRCHVMNILKSSNLVGRVGNLYNVICLTEK 355 Query: 180 KFVEMNILPYTEQLPKIHENYLAACDGQI 266 KF++ I P +LP++H+ Y+AAC QI Sbjct: 356 KFLDKVIFPNMARLPELHDTYIAACASQI 384 >ref|XP_002454274.2| transcription termination factor MTERF2, chloroplastic [Sorghum bicolor] gb|EES07243.2| hypothetical protein SORBI_3004G235300 [Sorghum bicolor] Length = 380 Score = 91.7 bits (226), Expect = 4e-18 Identities = 42/91 (46%), Positives = 64/91 (70%), Gaps = 1/91 (1%) Frame = +3 Query: 3 EFLVGRVGCDPSYVASRPLLLTLSLEKRLIPRHYVMDILRTNGIAAKR-NFYSIMCLPEK 179 EFL VG +PSYV +RP L++ S+E+RL+PRHYV+ IL+ G+ +K +FY +C+ E+ Sbjct: 288 EFLKMEVGLEPSYVLNRPALISYSIERRLMPRHYVIRILKAKGLLSKEIDFYGAVCITEE 347 Query: 180 KFVEMNILPYTEQLPKIHENYLAACDGQILI 272 KF+E ILPY + P + + Y AAC G++ + Sbjct: 348 KFLEKFILPYNKSFPGLIDAYAAACRGRVTL 378 >ref|XP_020244181.1| uncharacterized protein LOC109822395 [Asparagus officinalis] Length = 381 Score = 91.3 bits (225), Expect = 6e-18 Identities = 48/90 (53%), Positives = 61/90 (67%) Frame = +3 Query: 3 EFLVGRVGCDPSYVASRPLLLTLSLEKRLIPRHYVMDILRTNGIAAKRNFYSIMCLPEKK 182 EFLV GC+ S +AS PLLL SLEKRL PR+ V+ IL++N I R IM L EK Sbjct: 292 EFLVKEAGCEQSCIASNPLLLMFSLEKRLKPRNLVLQILKSNEIVQIRTLSYIMSLSEKT 351 Query: 183 FVEMNILPYTEQLPKIHENYLAACDGQILI 272 F++ +L + EQ+PKIHE YLAAC G++ I Sbjct: 352 FLQNIVLRHKEQVPKIHEIYLAACAGKLPI 381 >dbj|BAJ91610.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 393 Score = 91.3 bits (225), Expect = 6e-18 Identities = 41/89 (46%), Positives = 60/89 (67%), Gaps = 1/89 (1%) Frame = +3 Query: 3 EFLVGRVGCDPSYVASRPLLLTLSLEKRLIPRHYVMDILRTNGIAAK-RNFYSIMCLPEK 179 EFL+ VG +P Y+A RP +L SL+ RL PR+YV+ LR NG+ + R++YS+ CL EK Sbjct: 292 EFLISEVGLEPEYIAHRPAMLNYSLDVRLRPRYYVVKFLRANGLLDRDRDYYSVFCLVEK 351 Query: 180 KFVEMNILPYTEQLPKIHENYLAACDGQI 266 FV+ + PY E P + ++Y AAC G++ Sbjct: 352 VFVQRYVCPYKEAAPHLAQDYAAACSGEL 380 >ref|XP_020081254.1| transcription termination factor MTERF2, chloroplastic-like [Ananas comosus] ref|XP_020081255.1| transcription termination factor MTERF2, chloroplastic-like [Ananas comosus] ref|XP_020081257.1| transcription termination factor MTERF2, chloroplastic-like [Ananas comosus] ref|XP_020081258.1| transcription termination factor MTERF2, chloroplastic-like [Ananas comosus] ref|XP_020081259.1| transcription termination factor MTERF2, chloroplastic-like [Ananas comosus] ref|XP_020081260.1| transcription termination factor MTERF2, chloroplastic-like [Ananas comosus] ref|XP_020081261.1| transcription termination factor MTERF2, chloroplastic-like [Ananas comosus] ref|XP_020081262.1| transcription termination factor MTERF2, chloroplastic-like [Ananas comosus] ref|XP_020081263.1| transcription termination factor MTERF2, chloroplastic-like [Ananas comosus] ref|XP_020081264.1| transcription termination factor MTERF2, chloroplastic-like [Ananas comosus] Length = 382 Score = 90.5 bits (223), Expect = 1e-17 Identities = 44/88 (50%), Positives = 59/88 (67%) Frame = +3 Query: 3 EFLVGRVGCDPSYVASRPLLLTLSLEKRLIPRHYVMDILRTNGIAAKRNFYSIMCLPEKK 182 +FL+G+ GC P Y+ RP+LL SLEKRL+PRH+VM IL+ GI +FYS++ LPEK Sbjct: 293 DFLLGKAGCLPVYIKERPMLLAYSLEKRLVPRHHVMSILKEKGIGKYFSFYSVVGLPEKN 352 Query: 183 FVEMNILPYTEQLPKIHENYLAACDGQI 266 FVE I + +P + + Y AAC G I Sbjct: 353 FVEKFIRRNEKGMPGLDKVYAAACAGVI 380 >ref|XP_020093038.1| transcription termination factor MTERF2, chloroplastic-like [Ananas comosus] gb|OAY66308.1| hypothetical protein ACMD2_06373 [Ananas comosus] Length = 382 Score = 90.5 bits (223), Expect = 1e-17 Identities = 44/88 (50%), Positives = 59/88 (67%) Frame = +3 Query: 3 EFLVGRVGCDPSYVASRPLLLTLSLEKRLIPRHYVMDILRTNGIAAKRNFYSIMCLPEKK 182 +FL+G+ GC P Y+ RP+LL SLEKRL+PRH+VM IL+ GI +FYS++ LPEK Sbjct: 293 DFLLGKAGCLPVYIKERPMLLAYSLEKRLVPRHHVMSILKEKGIGKYFSFYSVVGLPEKN 352 Query: 183 FVEMNILPYTEQLPKIHENYLAACDGQI 266 FVE I + +P + + Y AAC G I Sbjct: 353 FVEKFIRRNEKGMPGLDKVYAAACAGVI 380 >ref|XP_021304237.1| transcription termination factor MTERF15, mitochondrial isoform X1 [Sorghum bicolor] ref|XP_021304238.1| transcription termination factor MTERF15, mitochondrial isoform X1 [Sorghum bicolor] gb|OQU76090.1| hypothetical protein SORBI_3010G091200 [Sorghum bicolor] Length = 402 Score = 89.7 bits (221), Expect = 2e-17 Identities = 42/89 (47%), Positives = 63/89 (70%), Gaps = 1/89 (1%) Frame = +3 Query: 3 EFLVGRVGCDPSYVASRPLLLTLSLEKRLIPRHYVMDILRTNGIAAK-RNFYSIMCLPEK 179 EFL+ +VG +P Y+A RP LLT SLE+RL+PRHYV++ L+ NG+ + R++Y+ + + E Sbjct: 299 EFLITKVGLEPEYIAHRPALLTYSLERRLMPRHYVVNYLKENGLLEQDRSYYTAVQVSEN 358 Query: 180 KFVEMNILPYTEQLPKIHENYLAACDGQI 266 F+E ILPY E P + +Y AAC G++ Sbjct: 359 VFMEKFILPYKEAAPSLALDYAAACRGEV 387 >gb|ONK60890.1| uncharacterized protein A4U43_C08F23770 [Asparagus officinalis] Length = 432 Score = 89.7 bits (221), Expect = 3e-17 Identities = 47/86 (54%), Positives = 58/86 (67%) Frame = +3 Query: 3 EFLVGRVGCDPSYVASRPLLLTLSLEKRLIPRHYVMDILRTNGIAAKRNFYSIMCLPEKK 182 EFLV GC+ S +AS PLLL SLEKRL PR+ V+ IL++N I R IM L EK Sbjct: 292 EFLVKEAGCEQSCIASNPLLLMFSLEKRLKPRNLVLQILKSNEIVQIRTLSYIMSLSEKT 351 Query: 183 FVEMNILPYTEQLPKIHENYLAACDG 260 F++ +L + EQ+PKIHE YLAAC G Sbjct: 352 FLQNIVLRHKEQVPKIHEIYLAACAG 377 >gb|EMS50729.1| hypothetical protein TRIUR3_09354 [Triticum urartu] Length = 182 Score = 85.1 bits (209), Expect = 5e-17 Identities = 42/89 (47%), Positives = 62/89 (69%), Gaps = 1/89 (1%) Frame = +3 Query: 3 EFLVGRVGCDPSYVASRPLLLTLSLEKRLIPRHYVMDILRTNGIAAK-RNFYSIMCLPEK 179 EFL +VG +P+Y+A RP +L LSLE+RL PR+YVM L+ NG+ + R++ S++ + EK Sbjct: 87 EFLFSKVGLEPAYIAHRPAILGLSLERRLEPRYYVMRFLKENGLLSHGRDYNSMVLVSEK 146 Query: 180 KFVEMNILPYTEQLPKIHENYLAACDGQI 266 FVE I P+ + P I E+Y AAC G++ Sbjct: 147 VFVERFIRPHKQAAPLIAEDYAAACTGEV 175 >ref|XP_020152400.1| uncharacterized protein LOC109737686 [Aegilops tauschii subsp. tauschii] Length = 384 Score = 88.6 bits (218), Expect = 5e-17 Identities = 42/89 (47%), Positives = 61/89 (68%), Gaps = 1/89 (1%) Frame = +3 Query: 3 EFLVGRVGCDPSYVASRPLLLTLSLEKRLIPRHYVMDILRTNGIAAK-RNFYSIMCLPEK 179 EFL+ VG +P+Y+A RP LLT SLE RL PRHYV+ L+ +G+ + R++Y + + EK Sbjct: 289 EFLISEVGLEPTYIAHRPALLTYSLEVRLRPRHYVVKFLKESGLLDRGRDYYRAVMISEK 348 Query: 180 KFVEMNILPYTEQLPKIHENYLAACDGQI 266 +FVE I P+ E P + E+Y AAC G++ Sbjct: 349 EFVEKFICPHKEAAPHLAEDYAAACKGEV 377 >ref|XP_020191155.1| uncharacterized protein LOC109776900 [Aegilops tauschii subsp. tauschii] ref|XP_020191164.1| uncharacterized protein LOC109776900 [Aegilops tauschii subsp. tauschii] Length = 384 Score = 88.2 bits (217), Expect = 7e-17 Identities = 42/89 (47%), Positives = 61/89 (68%), Gaps = 1/89 (1%) Frame = +3 Query: 3 EFLVGRVGCDPSYVASRPLLLTLSLEKRLIPRHYVMDILRTNGIAAK-RNFYSIMCLPEK 179 EFL+ VG +P+Y+A RP LLT SLE RL PRHYV+ L+ +G+ + R++Y + + EK Sbjct: 289 EFLISEVGLEPTYIAHRPALLTYSLEVRLRPRHYVVKFLKESGLLDRGRDYYRAVMISEK 348 Query: 180 KFVEMNILPYTEQLPKIHENYLAACDGQI 266 +FVE I P+ E P + E+Y AAC G++ Sbjct: 349 EFVEKFICPHKEAAPHLAEDYAAACRGEV 377 >ref|XP_020179313.1| uncharacterized protein LOC109764942 [Aegilops tauschii subsp. tauschii] Length = 384 Score = 88.2 bits (217), Expect = 7e-17 Identities = 42/89 (47%), Positives = 61/89 (68%), Gaps = 1/89 (1%) Frame = +3 Query: 3 EFLVGRVGCDPSYVASRPLLLTLSLEKRLIPRHYVMDILRTNGIAAK-RNFYSIMCLPEK 179 EFL+ VG +P+Y+A RP LLT SLE RL PRHYV+ L+ +G+ + R++Y + + EK Sbjct: 289 EFLISEVGLEPTYIAHRPALLTYSLEVRLRPRHYVVKFLKESGLLDRGRDYYRAVMISEK 348 Query: 180 KFVEMNILPYTEQLPKIHENYLAACDGQI 266 +FVE I P+ E P + E+Y AAC G++ Sbjct: 349 EFVEKFICPHKEAAPHLAEDYAAACRGEV 377 >gb|PAN24918.1| hypothetical protein PAHAL_C00328 [Panicum hallii] Length = 405 Score = 88.2 bits (217), Expect = 8e-17 Identities = 41/89 (46%), Positives = 62/89 (69%), Gaps = 1/89 (1%) Frame = +3 Query: 3 EFLVGRVGCDPSYVASRPLLLTLSLEKRLIPRHYVMDILRTNGIAAK-RNFYSIMCLPEK 179 EFL+ +VG +P Y+A RP LLT SLE+RL+PRHYV+ L+ NG+ + R++Y+ + + E Sbjct: 301 EFLITQVGLEPEYIAHRPALLTYSLERRLMPRHYVVKFLKENGLLEQDRSYYTAVQVSEN 360 Query: 180 KFVEMNILPYTEQLPKIHENYLAACDGQI 266 F+E I PY E P + ++Y AAC G++ Sbjct: 361 VFMEKFIHPYKEAAPSLAQDYAAACRGEV 389 >gb|PAN24917.1| hypothetical protein PAHAL_C00328 [Panicum hallii] Length = 407 Score = 88.2 bits (217), Expect = 9e-17 Identities = 41/89 (46%), Positives = 62/89 (69%), Gaps = 1/89 (1%) Frame = +3 Query: 3 EFLVGRVGCDPSYVASRPLLLTLSLEKRLIPRHYVMDILRTNGIAAK-RNFYSIMCLPEK 179 EFL+ +VG +P Y+A RP LLT SLE+RL+PRHYV+ L+ NG+ + R++Y+ + + E Sbjct: 301 EFLITQVGLEPEYIAHRPALLTYSLERRLMPRHYVVKFLKENGLLEQDRSYYTAVQVSEN 360 Query: 180 KFVEMNILPYTEQLPKIHENYLAACDGQI 266 F+E I PY E P + ++Y AAC G++ Sbjct: 361 VFMEKFIHPYKEAAPSLAQDYAAACRGEV 389 >ref|XP_020185296.1| uncharacterized protein LOC109770991 [Aegilops tauschii subsp. tauschii] ref|XP_020185297.1| uncharacterized protein LOC109770991 [Aegilops tauschii subsp. tauschii] ref|XP_020185298.1| uncharacterized protein LOC109770991 [Aegilops tauschii subsp. tauschii] Length = 385 Score = 87.8 bits (216), Expect = 1e-16 Identities = 42/89 (47%), Positives = 65/89 (73%), Gaps = 1/89 (1%) Frame = +3 Query: 3 EFLVGRVGCDPSYVASRPLLLTLSLEKRLIPRHYVMDILRTNGIAAK-RNFYSIMCLPEK 179 EFL+ +VG +P+Y+A RP++L+LSLE RL PR+YVM L+ NG+ + R++Y+++ + EK Sbjct: 290 EFLISKVGLEPAYIAHRPVMLSLSLEGRLKPRYYVMRFLQENGLLSHGRDYYAMVLVGEK 349 Query: 180 KFVEMNILPYTEQLPKIHENYLAACDGQI 266 FVE I P+ + P I E+Y AAC G++ Sbjct: 350 VFVERFIRPHKQAAPLIAEDYAAACIGEV 378 >gb|OEL23928.1| hypothetical protein BAE44_0015051 [Dichanthelium oligosanthes] Length = 382 Score = 87.4 bits (215), Expect = 1e-16 Identities = 40/89 (44%), Positives = 58/89 (65%), Gaps = 1/89 (1%) Frame = +3 Query: 3 EFLVGRVGCDPSYVASRPLLLTLSLEKRLIPRHYVMDILRTNGIAAKR-NFYSIMCLPEK 179 EFL VG +PSY+ RP + S+E+RL+PRH V+ IL+ G +K +FY +C+ E+ Sbjct: 290 EFLKVEVGLEPSYILHRPAMFAYSIERRLVPRHCVLRILKAKGSLSKEIDFYGAVCITEE 349 Query: 180 KFVEMNILPYTEQLPKIHENYLAACDGQI 266 FVE +LPY + +P + E Y AAC GQ+ Sbjct: 350 SFVEKFLLPYNKSVPGLIETYAAACQGQV 378 >ref|NP_001132554.1| putative mitochondrial transcription termination factor family protein [Zea mays] ref|XP_020403027.1| putative mitochondrial transcription termination factor family protein isoform X3 [Zea mays] gb|ACF81441.1| unknown [Zea mays] gb|ACG38629.1| mTERF family protein [Zea mays] gb|AIB05321.1| mTERF transcription factor, partial [Zea mays] gb|ONM24591.1| Mitochondrial transcription termination factor family protein [Zea mays] Length = 389 Score = 87.4 bits (215), Expect = 1e-16 Identities = 40/89 (44%), Positives = 62/89 (69%), Gaps = 1/89 (1%) Frame = +3 Query: 3 EFLVGRVGCDPSYVASRPLLLTLSLEKRLIPRHYVMDILRTNGIAAK-RNFYSIMCLPEK 179 EFL+ +VG +P Y+A RP LLT SLE+RL+PRHYV++ L+ NG+ + R++Y+ + + E Sbjct: 293 EFLITKVGLEPEYIAHRPALLTYSLERRLMPRHYVVNYLKENGLLEQDRSYYTAVQMSES 352 Query: 180 KFVEMNILPYTEQLPKIHENYLAACDGQI 266 F++ I PY E P + +Y AAC G++ Sbjct: 353 AFMDKFICPYKEAAPSLALDYAAACRGEV 381 >ref|XP_020575730.1| uncharacterized protein LOC110021537 isoform X2 [Phalaenopsis equestris] Length = 394 Score = 87.4 bits (215), Expect = 1e-16 Identities = 41/89 (46%), Positives = 62/89 (69%), Gaps = 1/89 (1%) Frame = +3 Query: 3 EFLVGRVGCDPSYVASRPLLLTLSLEKRLIPRHYVMDILRTNGIAAKR-NFYSIMCLPEK 179 +FLV GCD SY++S P + T SL KRL+PR+ V+ +L+T GI K+ FY++ + E+ Sbjct: 299 KFLVKEAGCDHSYLSSHPNIFTFSLSKRLVPRNQVLKLLKTKGILKKKLGFYNVSSMSER 358 Query: 180 KFVEMNILPYTEQLPKIHENYLAACDGQI 266 KFVE I Y E++P++H+ YL+A G+I Sbjct: 359 KFVEKFIFRYKEKMPELHDVYLSASAGEI 387 >ref|XP_020575729.1| uncharacterized protein LOC110021537 isoform X1 [Phalaenopsis equestris] Length = 399 Score = 87.4 bits (215), Expect = 2e-16 Identities = 41/89 (46%), Positives = 62/89 (69%), Gaps = 1/89 (1%) Frame = +3 Query: 3 EFLVGRVGCDPSYVASRPLLLTLSLEKRLIPRHYVMDILRTNGIAAKR-NFYSIMCLPEK 179 +FLV GCD SY++S P + T SL KRL+PR+ V+ +L+T GI K+ FY++ + E+ Sbjct: 299 KFLVKEAGCDHSYLSSHPNIFTFSLSKRLVPRNQVLKLLKTKGILKKKLGFYNVSSMSER 358 Query: 180 KFVEMNILPYTEQLPKIHENYLAACDGQI 266 KFVE I Y E++P++H+ YL+A G+I Sbjct: 359 KFVEKFIFRYKEKMPELHDVYLSASAGEI 387 >ref|XP_004965023.1| transcription termination factor MTERF8, chloroplastic-like [Setaria italica] Length = 399 Score = 87.4 bits (215), Expect = 2e-16 Identities = 41/88 (46%), Positives = 61/88 (69%), Gaps = 1/88 (1%) Frame = +3 Query: 3 EFLVGRVGCDPSYVASRPLLLTLSLEKRLIPRHYVMDILRTNGIAAK-RNFYSIMCLPEK 179 EFL+ +VG +P Y+A RP LLT SLE+RL+PRHYV+ L+ NG+ + R++Y+ + + E Sbjct: 301 EFLITQVGLEPEYIAHRPALLTYSLERRLMPRHYVVKFLKENGLLEQDRSYYTAVQVSEN 360 Query: 180 KFVEMNILPYTEQLPKIHENYLAACDGQ 263 F+E I PY E P + ++Y AAC G+ Sbjct: 361 VFMEKFIRPYKEAAPSLAQDYAAACRGE 388