BLASTX nr result
ID: Ophiopogon26_contig00033457
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00033457 (458 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX63252.1| hypothetical protein RirG_153980 [Rhizophagus irr... 107 2e-27 gb|PKC09878.1| hypothetical protein RhiirA5_356151 [Rhizophagus ... 90 5e-21 >gb|EXX63252.1| hypothetical protein RirG_153980 [Rhizophagus irregularis DAOM 197198w] dbj|GBC19063.1| hypothetical protein RIR_0670600 [Rhizophagus irregularis DAOM 181602] gb|PKK72097.1| hypothetical protein RhiirC2_743396 [Rhizophagus irregularis] Length = 80 Score = 107 bits (266), Expect = 2e-27 Identities = 50/80 (62%), Positives = 62/80 (77%), Gaps = 1/80 (1%) Frame = -2 Query: 436 MYATSVISRFGPKNMAMWLTVSVVGAATIYN-AKAQEQKLSIQHDWSLYSNDNVERLRNE 260 M A++ ISRFG KN MWLT S+VG AT+Y+ K+Q Q+ Q+D S +SN N+E LR+E Sbjct: 1 MNASNTISRFGSKNFTMWLTASIVGGATLYSFTKSQVQRTGFQYDLSSHSNGNIENLRSE 60 Query: 259 WKKQNNGFGLRDVTRSCGGV 200 WKKQNNG GL+DVTRSCGGV Sbjct: 61 WKKQNNGIGLKDVTRSCGGV 80 >gb|PKC09878.1| hypothetical protein RhiirA5_356151 [Rhizophagus irregularis] gb|PKC65290.1| hypothetical protein RhiirA1_420630 [Rhizophagus irregularis] gb|PKY22291.1| hypothetical protein RhiirB3_410438 [Rhizophagus irregularis] gb|PKY41945.1| hypothetical protein RhiirA4_396679 [Rhizophagus irregularis] gb|POG67915.1| hypothetical protein GLOIN_2v1642440 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 64 Score = 90.1 bits (222), Expect = 5e-21 Identities = 41/64 (64%), Positives = 51/64 (79%), Gaps = 1/64 (1%) Frame = -2 Query: 388 MWLTVSVVGAATIYN-AKAQEQKLSIQHDWSLYSNDNVERLRNEWKKQNNGFGLRDVTRS 212 MWLT S+VG AT+Y+ K+Q Q+ Q+D S +SN N+E LR+EWKKQNNG GL+DVTRS Sbjct: 1 MWLTASIVGGATLYSFTKSQVQRTGFQYDLSSHSNGNIENLRSEWKKQNNGIGLKDVTRS 60 Query: 211 CGGV 200 CGGV Sbjct: 61 CGGV 64