BLASTX nr result
ID: Ophiopogon26_contig00033258
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00033258 (453 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020083578.1| pentatricopeptide repeat-containing protein ... 58 9e-07 ref|XP_020083577.1| pentatricopeptide repeat-containing protein ... 58 9e-07 gb|OAY73747.1| Pentatricopeptide repeat-containing protein, part... 55 1e-05 >ref|XP_020083578.1| pentatricopeptide repeat-containing protein At1g76280 isoform X2 [Ananas comosus] Length = 830 Score = 57.8 bits (138), Expect = 9e-07 Identities = 29/51 (56%), Positives = 37/51 (72%) Frame = +3 Query: 297 SKTFQLHDQYYFRWRPQLGTRYAQIQVVNALHAGERERAVRMLLKLGNANG 449 S T HD +F WR +L +R+AQ+QVVNAL GERE+A MLL LG+A+G Sbjct: 37 SHTDGSHDYDHFGWRAKLVSRFAQLQVVNALRRGEREQASMMLLNLGHASG 87 >ref|XP_020083577.1| pentatricopeptide repeat-containing protein At1g76280 isoform X1 [Ananas comosus] Length = 835 Score = 57.8 bits (138), Expect = 9e-07 Identities = 29/51 (56%), Positives = 37/51 (72%) Frame = +3 Query: 297 SKTFQLHDQYYFRWRPQLGTRYAQIQVVNALHAGERERAVRMLLKLGNANG 449 S T HD +F WR +L +R+AQ+QVVNAL GERE+A MLL LG+A+G Sbjct: 37 SHTDGSHDYDHFGWRAKLVSRFAQLQVVNALRRGEREQASMMLLNLGHASG 87 >gb|OAY73747.1| Pentatricopeptide repeat-containing protein, partial [Ananas comosus] Length = 744 Score = 54.7 bits (130), Expect = 1e-05 Identities = 25/41 (60%), Positives = 33/41 (80%) Frame = +3 Query: 327 YFRWRPQLGTRYAQIQVVNALHAGERERAVRMLLKLGNANG 449 +F WR +L +R+AQ+QVVNAL GERE+A MLL LG+A+G Sbjct: 3 HFGWRAKLASRFAQLQVVNALRRGEREQASMMLLNLGHASG 43