BLASTX nr result
ID: Ophiopogon26_contig00033084
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00033084 (426 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK57408.1| uncharacterized protein A4U43_C09F210 [Asparagus ... 57 4e-08 >gb|ONK57408.1| uncharacterized protein A4U43_C09F210 [Asparagus officinalis] Length = 90 Score = 57.4 bits (137), Expect = 4e-08 Identities = 27/47 (57%), Positives = 35/47 (74%) Frame = -1 Query: 303 QGILTKQFHQVEILSDSHSHNSGFRTRFINAFFDGTEKLLYHVDNIL 163 +G+L +QFHQ EIL +SH +NS F +FI F DGT+KLL VD+IL Sbjct: 20 EGLLNEQFHQAEILRESHRNNSHFVAQFIATFCDGTQKLLADVDDIL 66