BLASTX nr result
ID: Ophiopogon26_contig00032877
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00032877 (434 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009382366.1| PREDICTED: LOW QUALITY PROTEIN: tripeptidyl-... 59 4e-07 dbj|GAV79300.1| Peptidase_S8 domain-containing protein/TPPII dom... 58 6e-07 ref|XP_021827097.1| tripeptidyl-peptidase 2 [Prunus avium] 58 8e-07 ref|XP_021301195.1| tripeptidyl-peptidase 2 [Herrania umbratica] 58 8e-07 ref|XP_008374083.1| PREDICTED: tripeptidyl-peptidase 2-like, par... 57 1e-06 gb|OAY76111.1| Tripeptidyl-peptidase 2 [Ananas comosus] 57 1e-06 ref|XP_020085379.1| tripeptidyl-peptidase 2 isoform X4 [Ananas c... 57 1e-06 gb|ONI25318.1| hypothetical protein PRUPE_2G295900 [Prunus persica] 57 1e-06 ref|XP_008234235.1| PREDICTED: tripeptidyl-peptidase 2 [Prunus m... 57 1e-06 ref|XP_007220303.2| tripeptidyl-peptidase 2 [Prunus persica] >gi... 57 1e-06 ref|XP_020085378.1| tripeptidyl-peptidase 2 isoform X3 [Ananas c... 57 1e-06 ref|XP_008376615.1| PREDICTED: tripeptidyl-peptidase 2 [Malus do... 57 1e-06 ref|XP_015878140.1| PREDICTED: tripeptidyl-peptidase 2 [Ziziphus... 57 1e-06 ref|XP_020085377.1| tripeptidyl-peptidase 2 isoform X2 [Ananas c... 57 1e-06 ref|XP_009340036.1| PREDICTED: tripeptidyl-peptidase 2-like isof... 57 1e-06 ref|XP_009340035.1| PREDICTED: tripeptidyl-peptidase 2-like isof... 57 1e-06 ref|XP_020085375.1| tripeptidyl-peptidase 2 isoform X1 [Ananas c... 57 1e-06 ref|XP_011030122.1| PREDICTED: tripeptidyl-peptidase 2-like isof... 57 1e-06 gb|PNT11059.1| hypothetical protein POPTR_012G142200v3 [Populus ... 57 1e-06 gb|PNT11060.1| hypothetical protein POPTR_012G142200v3 [Populus ... 57 1e-06 >ref|XP_009382366.1| PREDICTED: LOW QUALITY PROTEIN: tripeptidyl-peptidase 2 [Musa acuminata subsp. malaccensis] Length = 1369 Score = 58.5 bits (140), Expect = 4e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -1 Query: 434 LTMELAIAQFWSSGIGSHEATTVDFEVVYH 345 LTMELAIAQFWSSGIGSHEAT VDFE+ +H Sbjct: 821 LTMELAIAQFWSSGIGSHEATHVDFEIAFH 850 >dbj|GAV79300.1| Peptidase_S8 domain-containing protein/TPPII domain-containing protein [Cephalotus follicularis] Length = 1365 Score = 58.2 bits (139), Expect = 6e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -1 Query: 434 LTMELAIAQFWSSGIGSHEATTVDFEVVYH 345 LTMELAIAQFWSSGIGSH+ T VDFEVV+H Sbjct: 811 LTMELAIAQFWSSGIGSHDTTIVDFEVVFH 840 >ref|XP_021827097.1| tripeptidyl-peptidase 2 [Prunus avium] Length = 1351 Score = 57.8 bits (138), Expect = 8e-07 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -1 Query: 431 TMELAIAQFWSSGIGSHEATTVDFEVVYH 345 TMELAIAQFWSSGIGSHE T VDFE+V+H Sbjct: 812 TMELAIAQFWSSGIGSHETTNVDFEIVFH 840 >ref|XP_021301195.1| tripeptidyl-peptidase 2 [Herrania umbratica] Length = 1387 Score = 57.8 bits (138), Expect = 8e-07 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -1 Query: 431 TMELAIAQFWSSGIGSHEATTVDFEVVYH 345 TMELAIAQFWSSG+GSHEAT VDFE+V+H Sbjct: 835 TMELAIAQFWSSGMGSHEATIVDFEIVFH 863 >ref|XP_008374083.1| PREDICTED: tripeptidyl-peptidase 2-like, partial [Malus domestica] Length = 686 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -1 Query: 431 TMELAIAQFWSSGIGSHEATTVDFEVVYH 345 TMELAIAQFWSSGIGSHE T VDFE+V+H Sbjct: 183 TMELAIAQFWSSGIGSHETTIVDFEIVFH 211 >gb|OAY76111.1| Tripeptidyl-peptidase 2 [Ananas comosus] Length = 1213 Score = 57.4 bits (137), Expect = 1e-06 Identities = 29/36 (80%), Positives = 32/36 (88%), Gaps = 1/36 (2%) Frame = -1 Query: 434 LTMELAIAQFWSSGIGSHEATTVDFEVVYHQ-SSNL 330 LTMELAIAQFWSSGIGS EAT VDFE+V+H S+NL Sbjct: 730 LTMELAIAQFWSSGIGSDEATLVDFEIVFHGISTNL 765 >ref|XP_020085379.1| tripeptidyl-peptidase 2 isoform X4 [Ananas comosus] Length = 1278 Score = 57.4 bits (137), Expect = 1e-06 Identities = 29/36 (80%), Positives = 32/36 (88%), Gaps = 1/36 (2%) Frame = -1 Query: 434 LTMELAIAQFWSSGIGSHEATTVDFEVVYHQ-SSNL 330 LTMELAIAQFWSSGIGS EAT VDFE+V+H S+NL Sbjct: 728 LTMELAIAQFWSSGIGSDEATLVDFEIVFHGISTNL 763 >gb|ONI25318.1| hypothetical protein PRUPE_2G295900 [Prunus persica] Length = 1322 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -1 Query: 431 TMELAIAQFWSSGIGSHEATTVDFEVVYH 345 TMELAIAQFWSSGIGSHE T VDFE+V+H Sbjct: 815 TMELAIAQFWSSGIGSHETTIVDFEIVFH 843 >ref|XP_008234235.1| PREDICTED: tripeptidyl-peptidase 2 [Prunus mume] Length = 1351 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -1 Query: 431 TMELAIAQFWSSGIGSHEATTVDFEVVYH 345 TMELAIAQFWSSGIGSHE T VDFE+V+H Sbjct: 812 TMELAIAQFWSSGIGSHETTIVDFEIVFH 840 >ref|XP_007220303.2| tripeptidyl-peptidase 2 [Prunus persica] gb|ONI25319.1| hypothetical protein PRUPE_2G295900 [Prunus persica] Length = 1354 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -1 Query: 431 TMELAIAQFWSSGIGSHEATTVDFEVVYH 345 TMELAIAQFWSSGIGSHE T VDFE+V+H Sbjct: 815 TMELAIAQFWSSGIGSHETTIVDFEIVFH 843 >ref|XP_020085378.1| tripeptidyl-peptidase 2 isoform X3 [Ananas comosus] Length = 1361 Score = 57.4 bits (137), Expect = 1e-06 Identities = 29/36 (80%), Positives = 32/36 (88%), Gaps = 1/36 (2%) Frame = -1 Query: 434 LTMELAIAQFWSSGIGSHEATTVDFEVVYHQ-SSNL 330 LTMELAIAQFWSSGIGS EAT VDFE+V+H S+NL Sbjct: 811 LTMELAIAQFWSSGIGSDEATLVDFEIVFHGISTNL 846 >ref|XP_008376615.1| PREDICTED: tripeptidyl-peptidase 2 [Malus domestica] Length = 1366 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -1 Query: 431 TMELAIAQFWSSGIGSHEATTVDFEVVYH 345 TMELAIAQFWSSGIGSHE T VDFE+V+H Sbjct: 826 TMELAIAQFWSSGIGSHETTIVDFEIVFH 854 >ref|XP_015878140.1| PREDICTED: tripeptidyl-peptidase 2 [Ziziphus jujuba] Length = 1370 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -1 Query: 431 TMELAIAQFWSSGIGSHEATTVDFEVVYH 345 TMELAIAQFWSSGIGSHE T VDFE+V+H Sbjct: 818 TMELAIAQFWSSGIGSHETTIVDFEIVFH 846 >ref|XP_020085377.1| tripeptidyl-peptidase 2 isoform X2 [Ananas comosus] Length = 1371 Score = 57.4 bits (137), Expect = 1e-06 Identities = 29/36 (80%), Positives = 32/36 (88%), Gaps = 1/36 (2%) Frame = -1 Query: 434 LTMELAIAQFWSSGIGSHEATTVDFEVVYHQ-SSNL 330 LTMELAIAQFWSSGIGS EAT VDFE+V+H S+NL Sbjct: 821 LTMELAIAQFWSSGIGSDEATLVDFEIVFHGISTNL 856 >ref|XP_009340036.1| PREDICTED: tripeptidyl-peptidase 2-like isoform X2 [Pyrus x bretschneideri] Length = 1374 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -1 Query: 431 TMELAIAQFWSSGIGSHEATTVDFEVVYH 345 TMELAIAQFWSSGIGSHE T VDFE+V+H Sbjct: 829 TMELAIAQFWSSGIGSHETTIVDFEIVFH 857 >ref|XP_009340035.1| PREDICTED: tripeptidyl-peptidase 2-like isoform X1 [Pyrus x bretschneideri] Length = 1377 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -1 Query: 431 TMELAIAQFWSSGIGSHEATTVDFEVVYH 345 TMELAIAQFWSSGIGSHE T VDFE+V+H Sbjct: 829 TMELAIAQFWSSGIGSHETTIVDFEIVFH 857 >ref|XP_020085375.1| tripeptidyl-peptidase 2 isoform X1 [Ananas comosus] Length = 1406 Score = 57.4 bits (137), Expect = 1e-06 Identities = 29/36 (80%), Positives = 32/36 (88%), Gaps = 1/36 (2%) Frame = -1 Query: 434 LTMELAIAQFWSSGIGSHEATTVDFEVVYHQ-SSNL 330 LTMELAIAQFWSSGIGS EAT VDFE+V+H S+NL Sbjct: 856 LTMELAIAQFWSSGIGSDEATLVDFEIVFHGISTNL 891 >ref|XP_011030122.1| PREDICTED: tripeptidyl-peptidase 2-like isoform X3 [Populus euphratica] Length = 1145 Score = 57.0 bits (136), Expect = 1e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = -1 Query: 431 TMELAIAQFWSSGIGSHEATTVDFEVVYH 345 TMELA+AQFWSSGIGSHE T VDFE+V+H Sbjct: 824 TMELAVAQFWSSGIGSHETTIVDFEIVFH 852 >gb|PNT11059.1| hypothetical protein POPTR_012G142200v3 [Populus trichocarpa] Length = 1187 Score = 57.0 bits (136), Expect = 1e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = -1 Query: 431 TMELAIAQFWSSGIGSHEATTVDFEVVYH 345 TMELA+AQFWSSGIGSHE T VDFE+V+H Sbjct: 765 TMELAVAQFWSSGIGSHETTIVDFEIVFH 793 >gb|PNT11060.1| hypothetical protein POPTR_012G142200v3 [Populus trichocarpa] Length = 1221 Score = 57.0 bits (136), Expect = 1e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = -1 Query: 431 TMELAIAQFWSSGIGSHEATTVDFEVVYH 345 TMELA+AQFWSSGIGSHE T VDFE+V+H Sbjct: 687 TMELAVAQFWSSGIGSHETTIVDFEIVFH 715