BLASTX nr result
ID: Ophiopogon26_contig00032632
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00032632 (586 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020252021.1| geranylgeranyl transferase type-2 subunit be... 57 3e-06 ref|XP_020252020.1| geranylgeranyl transferase type-2 subunit be... 57 3e-06 >ref|XP_020252021.1| geranylgeranyl transferase type-2 subunit beta 1-like isoform X2 [Asparagus officinalis] Length = 323 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -2 Query: 582 VNYIVSCKNLDGGFGCTSGRQSHARQSMFF 493 VNYIVSCKNLDGGFGCT G +SHA QSM F Sbjct: 155 VNYIVSCKNLDGGFGCTPGGESHAGQSMLF 184 >ref|XP_020252020.1| geranylgeranyl transferase type-2 subunit beta 1-like isoform X1 [Asparagus officinalis] Length = 328 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -2 Query: 582 VNYIVSCKNLDGGFGCTSGRQSHARQSMFF 493 VNYIVSCKNLDGGFGCT G +SHA QSM F Sbjct: 155 VNYIVSCKNLDGGFGCTPGGESHAGQSMLF 184