BLASTX nr result
ID: Ophiopogon26_contig00032521
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00032521 (373 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN68757.1| hypothetical protein VITISV_035534 [Vitis vinifera] 78 5e-15 gb|ONK62295.1| uncharacterized protein A4U43_C07F2430 [Asparagus... 79 1e-14 ref|XP_020273517.1| LOW QUALITY PROTEIN: protein spotted leaf 11... 79 1e-14 emb|CBI16152.3| unnamed protein product, partial [Vitis vinifera] 78 2e-14 ref|XP_021668839.1| U-box domain-containing protein 13-like [Hev... 78 3e-14 ref|XP_002283992.1| PREDICTED: U-box domain-containing protein 1... 78 3e-14 ref|XP_008355146.1| PREDICTED: U-box domain-containing protein 1... 73 5e-14 ref|XP_010252135.1| PREDICTED: U-box domain-containing protein 1... 77 5e-14 ref|XP_021660831.1| U-box domain-containing protein 13-like isof... 77 5e-14 gb|OMO67744.1| Armadillo [Corchorus capsularis] 77 9e-14 gb|PHT24764.1| hypothetical protein CQW23_35564 [Capsicum baccatum] 72 1e-13 ref|XP_021627632.1| U-box domain-containing protein 13-like [Man... 76 1e-13 gb|EPS68981.1| hypothetical protein M569_05787, partial [Genlise... 76 2e-13 ref|XP_008465621.1| PREDICTED: U-box domain-containing protein 1... 72 2e-13 ref|XP_020214350.1| U-box domain-containing protein 13-like [Caj... 75 2e-13 gb|PIA39082.1| hypothetical protein AQUCO_02700332v1 [Aquilegia ... 75 2e-13 ref|XP_022949488.1| LOW QUALITY PROTEIN: U-box domain-containing... 75 2e-13 gb|PKA51936.1| U-box domain-containing protein 13 [Apostasia she... 75 3e-13 ref|XP_012065019.1| U-box domain-containing protein 13 [Jatropha... 75 3e-13 ref|XP_007132072.1| hypothetical protein PHAVU_011G064700g [Phas... 75 3e-13 >emb|CAN68757.1| hypothetical protein VITISV_035534 [Vitis vinifera] Length = 246 Score = 78.2 bits (191), Expect = 5e-15 Identities = 35/64 (54%), Positives = 49/64 (76%) Frame = -3 Query: 218 FLCISKKHLCNLARRIRLLVLMFEDIKDDRDPISRETARILTSLKAALDPTKELLRFGSD 39 + C +K CNLARR++LL+ MFE+I+D ++PI E+ + L SLK AL+ KELLRFGS+ Sbjct: 176 YRCTVRKEYCNLARRLKLLIPMFEEIRDSKEPIPEESLKALVSLKEALESAKELLRFGSE 235 Query: 38 GSKL 27 GSK+ Sbjct: 236 GSKI 239 >gb|ONK62295.1| uncharacterized protein A4U43_C07F2430 [Asparagus officinalis] Length = 566 Score = 79.3 bits (194), Expect = 1e-14 Identities = 40/61 (65%), Positives = 47/61 (77%) Frame = -3 Query: 203 KKHLCNLARRIRLLVLMFEDIKDDRDPISRETARILTSLKAALDPTKELLRFGSDGSKLC 24 +K L NLARRI+LLV M E+I+DD DPIS + A IL L+AALD KELL FGS GSK+C Sbjct: 31 RKQLFNLARRIKLLVTMLEEIRDDGDPISDQAAEILAPLRAALDSAKELLLFGSGGSKIC 90 Query: 23 L 21 L Sbjct: 91 L 91 >ref|XP_020273517.1| LOW QUALITY PROTEIN: protein spotted leaf 11-like [Asparagus officinalis] Length = 656 Score = 79.3 bits (194), Expect = 1e-14 Identities = 40/61 (65%), Positives = 47/61 (77%) Frame = -3 Query: 203 KKHLCNLARRIRLLVLMFEDIKDDRDPISRETARILTSLKAALDPTKELLRFGSDGSKLC 24 +K L NLARRI+LLV M E+I+DD DPIS + A IL L+AALD KELL FGS GSK+C Sbjct: 31 RKQLFNLARRIKLLVTMLEEIRDDGDPISDQAAEILAPLRAALDSAKELLLFGSGGSKIC 90 Query: 23 L 21 L Sbjct: 91 L 91 >emb|CBI16152.3| unnamed protein product, partial [Vitis vinifera] Length = 342 Score = 78.2 bits (191), Expect = 2e-14 Identities = 35/64 (54%), Positives = 49/64 (76%) Frame = -3 Query: 218 FLCISKKHLCNLARRIRLLVLMFEDIKDDRDPISRETARILTSLKAALDPTKELLRFGSD 39 + C +K CNLARR++LL+ MFE+I+D ++PI E+ + L SLK AL+ KELLRFGS+ Sbjct: 25 YRCTVRKEYCNLARRLKLLIPMFEEIRDSKEPIPEESLKALVSLKEALESAKELLRFGSE 84 Query: 38 GSKL 27 GSK+ Sbjct: 85 GSKI 88 >ref|XP_021668839.1| U-box domain-containing protein 13-like [Hevea brasiliensis] Length = 658 Score = 78.2 bits (191), Expect = 3e-14 Identities = 40/83 (48%), Positives = 58/83 (69%), Gaps = 1/83 (1%) Frame = -3 Query: 266 LVKFMLD-L*YVGIKMGFLCISKKHLCNLARRIRLLVLMFEDIKDDRDPISRETARILTS 90 LV+ ++D + +G + C KK CNLARR++LL+ +FE+I++ ++PI ETA+ L Sbjct: 8 LVQSLIDKVNQIGSISDYKCTVKKQYCNLARRLKLLMPLFEEIRESKEPIPEETAKALDL 67 Query: 89 LKAALDPTKELLRFGSDGSKLCL 21 LK ALD ELLRFGS+GSK+ L Sbjct: 68 LKQALDSANELLRFGSEGSKIYL 90 >ref|XP_002283992.1| PREDICTED: U-box domain-containing protein 13 isoform X1 [Vitis vinifera] Length = 682 Score = 78.2 bits (191), Expect = 3e-14 Identities = 35/64 (54%), Positives = 49/64 (76%) Frame = -3 Query: 218 FLCISKKHLCNLARRIRLLVLMFEDIKDDRDPISRETARILTSLKAALDPTKELLRFGSD 39 + C +K CNLARR++LL+ MFE+I+D ++PI E+ + L SLK AL+ KELLRFGS+ Sbjct: 25 YRCTVRKEYCNLARRLKLLIPMFEEIRDSKEPIPEESLKALVSLKEALESAKELLRFGSE 84 Query: 38 GSKL 27 GSK+ Sbjct: 85 GSKI 88 >ref|XP_008355146.1| PREDICTED: U-box domain-containing protein 13-like [Malus domestica] Length = 115 Score = 72.8 bits (177), Expect = 5e-14 Identities = 33/71 (46%), Positives = 49/71 (69%) Frame = -3 Query: 218 FLCISKKHLCNLARRIRLLVLMFEDIKDDRDPISRETARILTSLKAALDPTKELLRFGSD 39 + C+ KK CNLARR++LL MFE+I+D ++ +S++T + L S AL+ KELLRFG + Sbjct: 34 YRCVVKKQYCNLARRLKLLTPMFEEIRDSKEEVSQDTLKALLSFMEALESAKELLRFGGE 93 Query: 38 GSKLCLRTSII 6 SK+ L I+ Sbjct: 94 SSKIYLVNGIL 104 >ref|XP_010252135.1| PREDICTED: U-box domain-containing protein 13-like isoform X1 [Nelumbo nucifera] Length = 652 Score = 77.4 bits (189), Expect = 5e-14 Identities = 35/61 (57%), Positives = 48/61 (78%) Frame = -3 Query: 203 KKHLCNLARRIRLLVLMFEDIKDDRDPISRETARILTSLKAALDPTKELLRFGSDGSKLC 24 KK CNLARR++LL+ MFE+ K+ +DPI+ + + L SLK AL+ TKE+LRFGS+GSK+ Sbjct: 30 KKQYCNLARRLKLLIPMFEEFKESKDPITEDNVKALISLKEALESTKEILRFGSEGSKIF 89 Query: 23 L 21 L Sbjct: 90 L 90 >ref|XP_021660831.1| U-box domain-containing protein 13-like isoform X1 [Hevea brasiliensis] Length = 661 Score = 77.4 bits (189), Expect = 5e-14 Identities = 37/61 (60%), Positives = 47/61 (77%) Frame = -3 Query: 203 KKHLCNLARRIRLLVLMFEDIKDDRDPISRETARILTSLKAALDPTKELLRFGSDGSKLC 24 KK CNLARR++LL MFE+I++ ++PI ETA+ L LK ALD KELLRFGS+GSK+ Sbjct: 30 KKQYCNLARRLKLLTPMFEEIRESKEPIPEETAKALVLLKQALDSAKELLRFGSEGSKIY 89 Query: 23 L 21 L Sbjct: 90 L 90 >gb|OMO67744.1| Armadillo [Corchorus capsularis] Length = 672 Score = 76.6 bits (187), Expect = 9e-14 Identities = 37/66 (56%), Positives = 48/66 (72%) Frame = -3 Query: 218 FLCISKKHLCNLARRIRLLVLMFEDIKDDRDPISRETARILTSLKAALDPTKELLRFGSD 39 + C KK CNLARR++LL MFE+I++ ++PI ET + L SLK AL KELLRFGS+ Sbjct: 25 YRCPVKKQYCNLARRLKLLTPMFEEIRESKEPIPEETVKALVSLKEALVSAKELLRFGSE 84 Query: 38 GSKLCL 21 GSK+ L Sbjct: 85 GSKIYL 90 >gb|PHT24764.1| hypothetical protein CQW23_35564 [Capsicum baccatum] Length = 114 Score = 71.6 bits (174), Expect = 1e-13 Identities = 34/61 (55%), Positives = 47/61 (77%) Frame = -3 Query: 203 KKHLCNLARRIRLLVLMFEDIKDDRDPISRETARILTSLKAALDPTKELLRFGSDGSKLC 24 KK CNL RR++LL+ MFE+I+D ++ I E+ + L SLK AL+ TKELL+FGS+GSK+ Sbjct: 30 KKEYCNLGRRLKLLIPMFEEIRDIKEQIPEESMKALVSLKEALELTKELLKFGSEGSKIY 89 Query: 23 L 21 L Sbjct: 90 L 90 >ref|XP_021627632.1| U-box domain-containing protein 13-like [Manihot esculenta] gb|OAY37819.1| hypothetical protein MANES_11G131500 [Manihot esculenta] Length = 665 Score = 76.3 bits (186), Expect = 1e-13 Identities = 36/61 (59%), Positives = 47/61 (77%) Frame = -3 Query: 203 KKHLCNLARRIRLLVLMFEDIKDDRDPISRETARILTSLKAALDPTKELLRFGSDGSKLC 24 KK CNLARR++LL MFE+I++ ++PI ETA+ L LK ALD KELL+FGS+GSK+ Sbjct: 30 KKQYCNLARRLKLLTPMFEEIRESKEPIPEETAKALVLLKQALDSAKELLKFGSEGSKIY 89 Query: 23 L 21 L Sbjct: 90 L 90 >gb|EPS68981.1| hypothetical protein M569_05787, partial [Genlisea aurea] Length = 634 Score = 75.9 bits (185), Expect = 2e-13 Identities = 37/61 (60%), Positives = 48/61 (78%) Frame = -3 Query: 203 KKHLCNLARRIRLLVLMFEDIKDDRDPISRETARILTSLKAALDPTKELLRFGSDGSKLC 24 KK NLARR++LL MFE+I+D R+P+S ETA+ L SL +AL+ KELLRFGS+GSK+ Sbjct: 30 KKQYTNLARRLKLLTPMFEEIRDSREPLSEETAKALASLCSALESAKELLRFGSEGSKIY 89 Query: 23 L 21 L Sbjct: 90 L 90 >ref|XP_008465621.1| PREDICTED: U-box domain-containing protein 13-like [Cucumis melo] Length = 140 Score = 71.6 bits (174), Expect = 2e-13 Identities = 33/61 (54%), Positives = 47/61 (77%) Frame = -3 Query: 203 KKHLCNLARRIRLLVLMFEDIKDDRDPISRETARILTSLKAALDPTKELLRFGSDGSKLC 24 KK CNL+RR++LL+ MFE+I+D +D I+ +T + L LK AL+ K+LLRFGS+GSK+ Sbjct: 31 KKQYCNLSRRLKLLIPMFEEIRDSKDRITEDTLKALVLLKEALESAKKLLRFGSEGSKIF 90 Query: 23 L 21 L Sbjct: 91 L 91 >ref|XP_020214350.1| U-box domain-containing protein 13-like [Cajanus cajan] gb|KYP68190.1| U-box domain-containing protein 13 [Cajanus cajan] Length = 661 Score = 75.5 bits (184), Expect = 2e-13 Identities = 35/61 (57%), Positives = 48/61 (78%) Frame = -3 Query: 203 KKHLCNLARRIRLLVLMFEDIKDDRDPISRETARILTSLKAALDPTKELLRFGSDGSKLC 24 KKH CNLARR++LL+ MFE+I+D +DPI +T++ + + K AL+ ELLRFGS+GSKL Sbjct: 27 KKHYCNLARRLKLLIPMFEEIRDMKDPIPDDTSKAVLAFKEALESATELLRFGSEGSKLY 86 Query: 23 L 21 L Sbjct: 87 L 87 >gb|PIA39082.1| hypothetical protein AQUCO_02700332v1 [Aquilegia coerulea] Length = 664 Score = 75.5 bits (184), Expect = 2e-13 Identities = 36/66 (54%), Positives = 49/66 (74%) Frame = -3 Query: 218 FLCISKKHLCNLARRIRLLVLMFEDIKDDRDPISRETARILTSLKAALDPTKELLRFGSD 39 F C KK CNLARR++LL+ MFE+ K+ ++ +S ET + LTSLK L+ KELLRFGS+ Sbjct: 25 FRCAIKKQYCNLARRLKLLLPMFEEFKESKEDVSEETLKGLTSLKEGLELAKELLRFGSE 84 Query: 38 GSKLCL 21 GS++ L Sbjct: 85 GSQIYL 90 >ref|XP_022949488.1| LOW QUALITY PROTEIN: U-box domain-containing protein 13-like [Cucurbita moschata] Length = 667 Score = 75.5 bits (184), Expect = 2e-13 Identities = 34/61 (55%), Positives = 48/61 (78%) Frame = -3 Query: 203 KKHLCNLARRIRLLVLMFEDIKDDRDPISRETARILTSLKAALDPTKELLRFGSDGSKLC 24 KK CNL+RR++LL+ MFE+I+D ++P+S +T + L SLK AL+ K+LLRFGS GSK+ Sbjct: 30 KKQYCNLSRRLKLLIPMFEEIRDTKEPVSEDTLKALVSLKEALESAKKLLRFGSQGSKIF 89 Query: 23 L 21 L Sbjct: 90 L 90 >gb|PKA51936.1| U-box domain-containing protein 13 [Apostasia shenzhenica] Length = 659 Score = 75.1 bits (183), Expect = 3e-13 Identities = 37/61 (60%), Positives = 44/61 (72%) Frame = -3 Query: 203 KKHLCNLARRIRLLVLMFEDIKDDRDPISRETARILTSLKAALDPTKELLRFGSDGSKLC 24 KK CNL+RRIRLL MFE+++D R+PIS AR L L ALD LL+FGSDGSK+C Sbjct: 45 KKQFCNLSRRIRLLAPMFEELRDSREPISEGAARSLARLGDALDAATGLLQFGSDGSKIC 104 Query: 23 L 21 L Sbjct: 105 L 105 >ref|XP_012065019.1| U-box domain-containing protein 13 [Jatropha curcas] gb|KDP44223.1| hypothetical protein JCGZ_05690 [Jatropha curcas] Length = 663 Score = 75.1 bits (183), Expect = 3e-13 Identities = 36/66 (54%), Positives = 48/66 (72%) Frame = -3 Query: 218 FLCISKKHLCNLARRIRLLVLMFEDIKDDRDPISRETARILTSLKAALDPTKELLRFGSD 39 + C KK CNLARR++LL MFE+I++ ++PI E+ + L LK ALD KELLRFGS+ Sbjct: 25 YRCTVKKQYCNLARRLKLLTPMFEEIRESKEPIPDESMKALVLLKEALDLAKELLRFGSE 84 Query: 38 GSKLCL 21 GSK+ L Sbjct: 85 GSKIYL 90 >ref|XP_007132072.1| hypothetical protein PHAVU_011G064700g [Phaseolus vulgaris] gb|ESW04066.1| hypothetical protein PHAVU_011G064700g [Phaseolus vulgaris] Length = 670 Score = 75.1 bits (183), Expect = 3e-13 Identities = 34/61 (55%), Positives = 49/61 (80%) Frame = -3 Query: 203 KKHLCNLARRIRLLVLMFEDIKDDRDPISRETARILTSLKAALDPTKELLRFGSDGSKLC 24 KK CNLARR++LL+ MFE+I+D +DPI ++T++ + + K AL+ +ELLRFGS+GSKL Sbjct: 38 KKEYCNLARRLKLLIPMFEEIRDMKDPIPKDTSKAVLAFKEALESARELLRFGSEGSKLY 97 Query: 23 L 21 L Sbjct: 98 L 98