BLASTX nr result
ID: Ophiopogon26_contig00032509
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00032509 (488 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK69101.1| uncharacterized protein A4U43_C05F19370 [Asparagu... 78 2e-14 ref|XP_020264007.1| putative pentatricopeptide repeat-containing... 78 2e-14 >gb|ONK69101.1| uncharacterized protein A4U43_C05F19370 [Asparagus officinalis] Length = 1125 Score = 77.8 bits (190), Expect(2) = 2e-14 Identities = 47/85 (55%), Positives = 54/85 (63%) Frame = +2 Query: 182 MFRRLTQSKLQSFLPRLPKYSSSFAIAEDIIFDFDNELPIPSKSIFSMSNGIKVGDFGGK 361 M RRL +SKL+S L R PK+SSS IAE FDF NELPI S S S+ N I GK Sbjct: 1 MLRRLARSKLRSLL-RFPKFSSSADIAEVAFFDFHNELPINSNSHLSILNEIPSDRIRGK 59 Query: 362 GETFKDFEDSRVSILRACHHLGKRG 436 ++ K+ EDSRVS L ACH L K G Sbjct: 60 DDSCKESEDSRVSTLVACHCLAKVG 84 Score = 28.9 bits (63), Expect(2) = 2e-14 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +1 Query: 433 GKLNEIRGVLRLLIDKEG 486 GKL E+R +L+ LIDKEG Sbjct: 84 GKLKEVRRILKQLIDKEG 101 >ref|XP_020264007.1| putative pentatricopeptide repeat-containing protein At1g13630 isoform X1 [Asparagus officinalis] ref|XP_020264008.1| putative pentatricopeptide repeat-containing protein At1g13630 isoform X1 [Asparagus officinalis] ref|XP_020264009.1| putative pentatricopeptide repeat-containing protein At1g13630 isoform X1 [Asparagus officinalis] ref|XP_020264010.1| putative pentatricopeptide repeat-containing protein At1g13630 isoform X1 [Asparagus officinalis] Length = 793 Score = 77.8 bits (190), Expect(2) = 2e-14 Identities = 47/85 (55%), Positives = 54/85 (63%) Frame = +2 Query: 182 MFRRLTQSKLQSFLPRLPKYSSSFAIAEDIIFDFDNELPIPSKSIFSMSNGIKVGDFGGK 361 M RRL +SKL+S L R PK+SSS IAE FDF NELPI S S S+ N I GK Sbjct: 1 MLRRLARSKLRSLL-RFPKFSSSADIAEVAFFDFHNELPINSNSHLSILNEIPSDRIRGK 59 Query: 362 GETFKDFEDSRVSILRACHHLGKRG 436 ++ K+ EDSRVS L ACH L K G Sbjct: 60 DDSCKESEDSRVSTLVACHCLAKVG 84 Score = 28.9 bits (63), Expect(2) = 2e-14 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +1 Query: 433 GKLNEIRGVLRLLIDKEG 486 GKL E+R +L+ LIDKEG Sbjct: 84 GKLKEVRRILKQLIDKEG 101