BLASTX nr result
ID: Ophiopogon26_contig00032506
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00032506 (597 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKA66517.1| Putative F-box/LRR-repeat protein [Apostasia shen... 60 6e-07 gb|OAO91990.1| hypothetical protein AXX17_AT5G56030 [Arabidopsis... 57 4e-06 >gb|PKA66517.1| Putative F-box/LRR-repeat protein [Apostasia shenzhenica] Length = 514 Score = 59.7 bits (143), Expect = 6e-07 Identities = 31/58 (53%), Positives = 39/58 (67%) Frame = +3 Query: 408 PKMTKTGSREVTADNCDRISQLSDDILIHILSFLHYKDDIGPTTSLLSKRWRYLWRDL 581 P + G RE D+C+RIS+L D +L+HILSFL D I TSLL +RWRYLWR + Sbjct: 17 PPKFRVGERE---DDCERISELPDHLLLHILSFLCIDDAI--PTSLLCRRWRYLWRSI 69 >gb|OAO91990.1| hypothetical protein AXX17_AT5G56030 [Arabidopsis thaliana] Length = 1076 Score = 57.4 bits (137), Expect = 4e-06 Identities = 31/62 (50%), Positives = 42/62 (67%) Frame = +3 Query: 390 DWFCPNPKMTKTGSREVTADNCDRISQLSDDILIHILSFLHYKDDIGPTTSLLSKRWRYL 569 DW P++ GS EV+ DRIS L DD+L+ ILSF+H D I +TSLLSKRW+++ Sbjct: 448 DWAMKAPRL---GSEEVSYS--DRISYLPDDLLLRILSFIHTSDAI--STSLLSKRWKFV 500 Query: 570 WR 575 W+ Sbjct: 501 WK 502