BLASTX nr result
ID: Ophiopogon26_contig00032218
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00032218 (515 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX76728.1| hypothetical protein RirG_030450 [Rhizophagus irr... 205 1e-65 gb|PKB92764.1| hypothetical protein RhiirA5_368426, partial [Rhi... 84 2e-18 >gb|EXX76728.1| hypothetical protein RirG_030450 [Rhizophagus irregularis DAOM 197198w] dbj|GBC26593.1| extender of the chronological lifespan protein ecl2 [Rhizophagus irregularis DAOM 181602] gb|POG61863.1| hypothetical protein GLOIN_2v1701013 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 120 Score = 205 bits (522), Expect = 1e-65 Identities = 102/120 (85%), Positives = 103/120 (85%), Gaps = 1/120 (0%) Frame = -1 Query: 512 MDTDWCIMCDSHCNIPGAIYCSKECELQDRLTAYPXXXXXXXXXXXXXSGV-TKFERTTS 336 MDTDWCIMCDSHCNIPGAIYCSKECELQDRL+AYP SGV TKFERTTS Sbjct: 1 MDTDWCIMCDSHCNIPGAIYCSKECELQDRLSAYPSLTSSSSISTQYSSGVNTKFERTTS 60 Query: 335 VKFPPKSASIQFPKVQQLQQQSTLFYHRGPMPRYKHTSSKACASASNVRDRKVAKSLYVQ 156 VKFP KSASIQFPKVQQLQQQ TLFYHRGPMPRYKHTSSKACASASNVRDRKV KSLYVQ Sbjct: 61 VKFPTKSASIQFPKVQQLQQQPTLFYHRGPMPRYKHTSSKACASASNVRDRKVTKSLYVQ 120 >gb|PKB92764.1| hypothetical protein RhiirA5_368426, partial [Rhizophagus irregularis] gb|PKC51783.1| hypothetical protein RhiirA1_430286, partial [Rhizophagus irregularis] gb|PKK79628.1| hypothetical protein RhiirC2_726734, partial [Rhizophagus irregularis] gb|PKY16690.1| hypothetical protein RhiirB3_403198, partial [Rhizophagus irregularis] gb|PKY42160.1| hypothetical protein RhiirA4_397044, partial [Rhizophagus irregularis] Length = 51 Score = 83.6 bits (205), Expect = 2e-18 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -1 Query: 512 MDTDWCIMCDSHCNIPGAIYCSKECELQDRLTAYP 408 MDTDWCIMCDSHCNIPGAIYCSKECELQDRL+AYP Sbjct: 1 MDTDWCIMCDSHCNIPGAIYCSKECELQDRLSAYP 35