BLASTX nr result
ID: Ophiopogon26_contig00032173
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00032173 (429 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008784008.2| PREDICTED: pentatricopeptide repeat-containi... 100 6e-22 ref|XP_010912274.1| PREDICTED: pentatricopeptide repeat-containi... 99 3e-21 ref|XP_020693454.1| pentatricopeptide repeat-containing protein ... 92 1e-18 gb|PKU64357.1| Pentatricopeptide repeat-containing protein [Dend... 92 1e-18 ref|XP_009407344.1| PREDICTED: pentatricopeptide repeat-containi... 81 4e-15 ref|XP_009407342.1| PREDICTED: pentatricopeptide repeat-containi... 81 4e-15 gb|PIA63666.1| hypothetical protein AQUCO_00201186v1, partial [A... 70 3e-11 ref|XP_010250739.1| PREDICTED: pentatricopeptide repeat-containi... 66 1e-09 gb|OVA19084.1| Pentatricopeptide repeat [Macleaya cordata] 65 1e-09 ref|XP_023892671.1| pentatricopeptide repeat-containing protein ... 62 3e-08 ref|XP_004498286.1| PREDICTED: pentatricopeptide repeat-containi... 60 8e-08 ref|XP_024196612.1| pentatricopeptide repeat-containing protein ... 60 8e-08 ref|XP_022881935.1| pentatricopeptide repeat-containing protein ... 60 1e-07 ref|XP_022881938.1| pentatricopeptide repeat-containing protein ... 59 4e-07 ref|XP_022881937.1| pentatricopeptide repeat-containing protein ... 59 4e-07 ref|XP_022881936.1| pentatricopeptide repeat-containing protein ... 59 4e-07 ref|XP_011070737.1| pentatricopeptide repeat-containing protein ... 59 4e-07 gb|KMZ66069.1| hypothetical protein ZOSMA_2G00810 [Zostera marina] 57 9e-07 ref|XP_010096735.1| pentatricopeptide repeat-containing protein ... 57 1e-06 gb|KRH16451.1| hypothetical protein GLYMA_14G156100 [Glycine max] 56 2e-06 >ref|XP_008784008.2| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial [Phoenix dactylifera] Length = 723 Score = 100 bits (250), Expect = 6e-22 Identities = 51/93 (54%), Positives = 67/93 (72%), Gaps = 3/93 (3%) Frame = +1 Query: 160 LSSSKPYVV---EKPQPPQLQSPVLALLQSNPNAFRPNFKSPAAFKPFISNRAQFLSALD 330 L SSKPY + PQPP L++ + +L SNP AF +F +P + KP I++R FLSALD Sbjct: 32 LLSSKPYSQLDPQTPQPPSLETLLSDILDSNPLAFTRDFVAPDSLKPLIADRDLFLSALD 91 Query: 331 SIRHRPKIALRFFRWAERQQGFERSEAAFSAIL 429 S+R RP++ALRFFRWAERQ GF+ S+ AF A+L Sbjct: 92 SVRRRPRLALRFFRWAERQPGFDHSDIAFLAVL 124 >ref|XP_010912274.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial [Elaeis guineensis] ref|XP_019704077.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial [Elaeis guineensis] ref|XP_019704078.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial [Elaeis guineensis] ref|XP_019704079.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial [Elaeis guineensis] ref|XP_019704080.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial [Elaeis guineensis] Length = 724 Score = 99.0 bits (245), Expect = 3e-21 Identities = 52/94 (55%), Positives = 65/94 (69%), Gaps = 3/94 (3%) Frame = +1 Query: 157 FLSSSKPYV---VEKPQPPQLQSPVLALLQSNPNAFRPNFKSPAAFKPFISNRAQFLSAL 327 FL SSKPY + PQ P L + + +L SNP AF +F +P + KP I +R FLSAL Sbjct: 32 FLLSSKPYSHLDPQTPQTPSLDTLLSDILDSNPLAFTRDFAAPDSLKPVIVDRDLFLSAL 91 Query: 328 DSIRHRPKIALRFFRWAERQQGFERSEAAFSAIL 429 DS+R RP++ALRFFRWAERQ GF+ SE AF A+L Sbjct: 92 DSVRSRPRLALRFFRWAERQPGFDHSEIAFLAVL 125 >ref|XP_020693454.1| pentatricopeptide repeat-containing protein At1g22960, mitochondrial [Dendrobium catenatum] ref|XP_020693506.1| pentatricopeptide repeat-containing protein At1g22960, mitochondrial [Dendrobium catenatum] Length = 720 Score = 91.7 bits (226), Expect = 1e-18 Identities = 44/88 (50%), Positives = 59/88 (67%) Frame = +1 Query: 166 SSKPYVVEKPQPPQLQSPVLALLQSNPNAFRPNFKSPAAFKPFISNRAQFLSALDSIRHR 345 S KP+ + PQ S +L +L+ NP+AF F++PA KP IS+R FL + SI ++ Sbjct: 35 SHKPFSKLLTEKPQFDSLILGILKYNPHAFTSGFRAPARLKPLISDRHLFLCTIHSIGNQ 94 Query: 346 PKIALRFFRWAERQQGFERSEAAFSAIL 429 P++ALRFFRWAERQ GF RSE F A+L Sbjct: 95 PRVALRFFRWAERQPGFHRSEIPFCAVL 122 >gb|PKU64357.1| Pentatricopeptide repeat-containing protein [Dendrobium catenatum] Length = 779 Score = 91.7 bits (226), Expect = 1e-18 Identities = 44/88 (50%), Positives = 59/88 (67%) Frame = +1 Query: 166 SSKPYVVEKPQPPQLQSPVLALLQSNPNAFRPNFKSPAAFKPFISNRAQFLSALDSIRHR 345 S KP+ + PQ S +L +L+ NP+AF F++PA KP IS+R FL + SI ++ Sbjct: 94 SHKPFSKLLTEKPQFDSLILGILKYNPHAFTSGFRAPARLKPLISDRHLFLCTIHSIGNQ 153 Query: 346 PKIALRFFRWAERQQGFERSEAAFSAIL 429 P++ALRFFRWAERQ GF RSE F A+L Sbjct: 154 PRVALRFFRWAERQPGFHRSEIPFCAVL 181 >ref|XP_009407344.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial isoform X2 [Musa acuminata subsp. malaccensis] Length = 679 Score = 81.3 bits (199), Expect = 4e-15 Identities = 44/94 (46%), Positives = 60/94 (63%) Frame = +1 Query: 148 VRSFLSSSKPYVVEKPQPPQLQSPVLALLQSNPNAFRPNFKSPAAFKPFISNRAQFLSAL 327 ++++ SSS V+ P L S +L S+P AF F++P + KP +S FL+AL Sbjct: 46 IKAYYSSSSSSPVDIPPFDALVS---GILDSDPAAFTRGFRAPDSIKPLLSEPHLFLAAL 102 Query: 328 DSIRHRPKIALRFFRWAERQQGFERSEAAFSAIL 429 S+R RP++ALRFFRWAE Q GF SEAAF A+L Sbjct: 103 RSVRRRPRLALRFFRWAESQPGFPCSEAAFCAVL 136 >ref|XP_009407342.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial isoform X1 [Musa acuminata subsp. malaccensis] Length = 704 Score = 81.3 bits (199), Expect = 4e-15 Identities = 44/94 (46%), Positives = 60/94 (63%) Frame = +1 Query: 148 VRSFLSSSKPYVVEKPQPPQLQSPVLALLQSNPNAFRPNFKSPAAFKPFISNRAQFLSAL 327 ++++ SSS V+ P L S +L S+P AF F++P + KP +S FL+AL Sbjct: 46 IKAYYSSSSSSPVDIPPFDALVS---GILDSDPAAFTRGFRAPDSIKPLLSEPHLFLAAL 102 Query: 328 DSIRHRPKIALRFFRWAERQQGFERSEAAFSAIL 429 S+R RP++ALRFFRWAE Q GF SEAAF A+L Sbjct: 103 RSVRRRPRLALRFFRWAESQPGFPCSEAAFCAVL 136 >gb|PIA63666.1| hypothetical protein AQUCO_00201186v1, partial [Aquilegia coerulea] Length = 624 Score = 70.5 bits (171), Expect = 3e-11 Identities = 37/63 (58%), Positives = 42/63 (66%) Frame = +1 Query: 241 NPNAFRPNFKSPAAFKPFISNRAQFLSALDSIRHRPKIALRFFRWAERQQGFERSEAAFS 420 N AF F FK + N+ FL ALDSIR RPK+ALRFF+WAE Q GF+RSE AF Sbjct: 62 NRYAFTHEFWMSDQFKVIVYNQELFLRALDSIRERPKVALRFFKWAEIQPGFKRSEYAFC 121 Query: 421 AIL 429 AIL Sbjct: 122 AIL 124 >ref|XP_010250739.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial [Nelumbo nucifera] Length = 627 Score = 65.9 bits (159), Expect = 1e-09 Identities = 34/73 (46%), Positives = 44/73 (60%) Frame = +1 Query: 211 QSPVLALLQSNPNAFRPNFKSPAAFKPFISNRAQFLSALDSIRHRPKIALRFFRWAERQQ 390 Q + + +NP AF NF F+P I + FL L SIR RP+I LRFF WAE+Q Sbjct: 84 QELIYKTIDNNPWAFTHNFWVSDQFEPVIVDPDLFLRVLKSIRRRPRIVLRFFLWAEKQP 143 Query: 391 GFERSEAAFSAIL 429 GF R+E AF ++L Sbjct: 144 GFIRTEVAFCSVL 156 >gb|OVA19084.1| Pentatricopeptide repeat [Macleaya cordata] Length = 784 Score = 65.5 bits (158), Expect = 1e-09 Identities = 35/66 (53%), Positives = 43/66 (65%) Frame = +1 Query: 232 LQSNPNAFRPNFKSPAAFKPFISNRAQFLSALDSIRHRPKIALRFFRWAERQQGFERSEA 411 ++ N AF NF F+P I + FL L+SIR RP++ALRFFRWAE Q GF+RSE Sbjct: 115 IKRNRWAFTHNFWVSDRFQPIIVDPDLFLVVLNSIRKRPRVALRFFRWAEIQPGFKRSEF 174 Query: 412 AFSAIL 429 AF IL Sbjct: 175 AFCTIL 180 >ref|XP_023892671.1| pentatricopeptide repeat-containing protein At1g22960, mitochondrial [Quercus suber] gb|POE60531.1| pentatricopeptide repeat-containing protein, mitochondrial [Quercus suber] Length = 735 Score = 61.6 bits (148), Expect = 3e-08 Identities = 34/75 (45%), Positives = 44/75 (58%) Frame = +1 Query: 205 QLQSPVLALLQSNPNAFRPNFKSPAAFKPFISNRAQFLSALDSIRHRPKIALRFFRWAER 384 Q + + ++ P AF N F+ I + F+ LDSIR RP+IALRFFRW E Sbjct: 57 QYRDLIFDTIEEKPWAFCNNNWVSDQFRAVIVDPELFIRVLDSIRIRPRIALRFFRWVEG 116 Query: 385 QQGFERSEAAFSAIL 429 Q GF+RSE AF A+L Sbjct: 117 QPGFKRSEFAFCAML 131 >ref|XP_004498286.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial [Cicer arietinum] ref|XP_012570598.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial [Cicer arietinum] ref|XP_012570600.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial [Cicer arietinum] ref|XP_012570601.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial [Cicer arietinum] Length = 696 Score = 60.5 bits (145), Expect = 8e-08 Identities = 27/49 (55%), Positives = 37/49 (75%) Frame = +1 Query: 283 FKPFISNRAQFLSALDSIRHRPKIALRFFRWAERQQGFERSEAAFSAIL 429 F+ ++ L L+S++HRP +ALRFFRWAE+Q GF+RSE+AF AIL Sbjct: 46 FRAAVTQPELLLRVLNSVKHRPILALRFFRWAEKQSGFKRSESAFVAIL 94 >ref|XP_024196612.1| pentatricopeptide repeat-containing protein At1g22960, mitochondrial [Rosa chinensis] gb|PRQ40251.1| putative tetratricopeptide-like helical domain-containing protein [Rosa chinensis] Length = 714 Score = 60.5 bits (145), Expect = 8e-08 Identities = 31/70 (44%), Positives = 42/70 (60%) Frame = +1 Query: 220 VLALLQSNPNAFRPNFKSPAAFKPFISNRAQFLSALDSIRHRPKIALRFFRWAERQQGFE 399 + + +++ P+AFR S F+P IS+ F+ L IR RP +ALRFFRWAE Q + Sbjct: 44 IFSTIRTTPSAFRTRDWSSHRFRPVISDPDLFVRVLAQIRARPTVALRFFRWAEAQPEVK 103 Query: 400 RSEAAFSAIL 429 RSE F IL Sbjct: 104 RSEFVFCVIL 113 >ref|XP_022881935.1| pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like [Olea europaea var. sylvestris] Length = 571 Score = 60.1 bits (144), Expect = 1e-07 Identities = 30/71 (42%), Positives = 41/71 (57%), Gaps = 1/71 (1%) Frame = +1 Query: 220 VLALLQSNPNAFRPNF-KSPAAFKPFISNRAQFLSALDSIRHRPKIALRFFRWAERQQGF 396 +L L NP AF+ + + P F I + F++ L SIRHRP + L FRWAE Q+GF Sbjct: 78 ILKTLHENPRAFKNTYWEVPDYFNVLIIDSELFINVLKSIRHRPSVVLGLFRWAEVQKGF 137 Query: 397 ERSEAAFSAIL 429 + SE F +L Sbjct: 138 KHSEFVFCTVL 148 >ref|XP_022881938.1| pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X3 [Olea europaea var. sylvestris] Length = 521 Score = 58.5 bits (140), Expect = 4e-07 Identities = 29/71 (40%), Positives = 40/71 (56%), Gaps = 1/71 (1%) Frame = +1 Query: 220 VLALLQSNPNAFRPNF-KSPAAFKPFISNRAQFLSALDSIRHRPKIALRFFRWAERQQGF 396 +L L NP AF+ + + P F I + F++ L SIRHRP + L FRW E Q+GF Sbjct: 78 ILKTLHENPRAFKNTYWEVPDYFNVLIIDSELFINVLKSIRHRPSVVLGLFRWVEVQKGF 137 Query: 397 ERSEAAFSAIL 429 + SE F +L Sbjct: 138 KHSEFVFCTVL 148 >ref|XP_022881937.1| pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X2 [Olea europaea var. sylvestris] Length = 524 Score = 58.5 bits (140), Expect = 4e-07 Identities = 29/71 (40%), Positives = 40/71 (56%), Gaps = 1/71 (1%) Frame = +1 Query: 220 VLALLQSNPNAFRPNF-KSPAAFKPFISNRAQFLSALDSIRHRPKIALRFFRWAERQQGF 396 +L L NP AF+ + + P F I + F++ L SIRHRP + L FRW E Q+GF Sbjct: 78 ILKTLHENPRAFKNTYWEVPDYFNVLIIDSELFINVLKSIRHRPSVVLGLFRWVEVQKGF 137 Query: 397 ERSEAAFSAIL 429 + SE F +L Sbjct: 138 KHSEFVFCTVL 148 >ref|XP_022881936.1| pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X1 [Olea europaea var. sylvestris] Length = 537 Score = 58.5 bits (140), Expect = 4e-07 Identities = 29/71 (40%), Positives = 40/71 (56%), Gaps = 1/71 (1%) Frame = +1 Query: 220 VLALLQSNPNAFRPNF-KSPAAFKPFISNRAQFLSALDSIRHRPKIALRFFRWAERQQGF 396 +L L NP AF+ + + P F I + F++ L SIRHRP + L FRW E Q+GF Sbjct: 78 ILKTLHENPRAFKNTYWEVPDYFNVLIIDSELFINVLKSIRHRPSVVLGLFRWVEVQKGF 137 Query: 397 ERSEAAFSAIL 429 + SE F +L Sbjct: 138 KHSEFVFCTVL 148 >ref|XP_011070737.1| pentatricopeptide repeat-containing protein At1g22960, mitochondrial isoform X1 [Sesamum indicum] ref|XP_011070739.1| pentatricopeptide repeat-containing protein At1g22960, mitochondrial isoform X1 [Sesamum indicum] Length = 761 Score = 58.5 bits (140), Expect = 4e-07 Identities = 29/74 (39%), Positives = 45/74 (60%), Gaps = 1/74 (1%) Frame = +1 Query: 211 QSPVLALLQSNPNAFRP-NFKSPAAFKPFISNRAQFLSALDSIRHRPKIALRFFRWAERQ 387 Q+ +L NP AFR ++ P F + + FLS ++S+R+RP++ L+ FRWAE Q Sbjct: 84 QNLILKTAMENPGAFRDIHWVVPDYFNALVIDSDLFLSVVNSMRNRPRMVLKIFRWAEGQ 143 Query: 388 QGFERSEAAFSAIL 429 GF+ SE F ++L Sbjct: 144 NGFKHSEFVFCSVL 157 >gb|KMZ66069.1| hypothetical protein ZOSMA_2G00810 [Zostera marina] Length = 721 Score = 57.4 bits (137), Expect = 9e-07 Identities = 34/94 (36%), Positives = 48/94 (51%) Frame = +1 Query: 148 VRSFLSSSKPYVVEKPQPPQLQSPVLALLQSNPNAFRPNFKSPAAFKPFISNRAQFLSAL 327 +R+ +S S+P P Q+ + + A P+ P P KP IS+ FLS L Sbjct: 29 LRTHVSQSQP-----PHAIQIAAFIHAQFTIKPHLQSP---PPGILKPVISDHGLFLSVL 80 Query: 328 DSIRHRPKIALRFFRWAERQQGFERSEAAFSAIL 429 DS+R P + RFFRWA+ Q GFE + F +L Sbjct: 81 DSVRSHPLVVFRFFRWADGQPGFEPTCDTFRTVL 114 >ref|XP_010096735.1| pentatricopeptide repeat-containing protein At1g22960, mitochondrial [Morus notabilis] ref|XP_024021601.1| pentatricopeptide repeat-containing protein At1g22960, mitochondrial [Morus notabilis] gb|EXB65587.1| hypothetical protein L484_025853 [Morus notabilis] Length = 742 Score = 57.0 bits (136), Expect = 1e-06 Identities = 33/72 (45%), Positives = 43/72 (59%), Gaps = 2/72 (2%) Frame = +1 Query: 220 VLALLQSNPNAF-RPNFKSPA-AFKPFISNRAQFLSALDSIRHRPKIALRFFRWAERQQG 393 +++ ++ P AF PN+ P +P I + F L SIR +P+IALRFFRWAE Q Sbjct: 66 IISAIEEKPWAFSNPNWVVPDHQLRPVILDPYLFARVLRSIREKPRIALRFFRWAEGQPE 125 Query: 394 FERSEAAFSAIL 429 F RSE F AIL Sbjct: 126 FRRSEFGFCAIL 137 >gb|KRH16451.1| hypothetical protein GLYMA_14G156100 [Glycine max] Length = 687 Score = 56.2 bits (134), Expect = 2e-06 Identities = 24/49 (48%), Positives = 34/49 (69%) Frame = +1 Query: 283 FKPFISNRAQFLSALDSIRHRPKIALRFFRWAERQQGFERSEAAFSAIL 429 F ++ + L+++RHRP +ALRFFRWAERQ GF+RSE ++ IL Sbjct: 40 FHAAVAEPQLLVRVLNTVRHRPAVALRFFRWAERQTGFKRSELTYAVIL 88