BLASTX nr result
ID: Ophiopogon26_contig00032138
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00032138 (698 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK69625.1| uncharacterized protein A4U43_C05F24960 [Asparagu... 75 3e-12 >gb|ONK69625.1| uncharacterized protein A4U43_C05F24960 [Asparagus officinalis] Length = 268 Score = 74.7 bits (182), Expect = 3e-12 Identities = 49/115 (42%), Positives = 61/115 (53%), Gaps = 1/115 (0%) Frame = +2 Query: 320 AGKRQPTAGKPIEKPSLTSRKPIERTLSTPTATREQXXXXXXXXXXXXXXXXXXTSLLPL 499 + KRQP KP+EKP SRKP+ RTLSTP +RE+ SL+ Sbjct: 49 SAKRQPLTKKPLEKPPSPSRKPV-RTLSTPITSRERSPRVPSPTPSPVPRPQRSNSLI-- 105 Query: 500 DKGAKSAARGVKTGSLTRSKSFEKRKAVAVS-SAHVDTSSASDSEASVIKKTELE 661 + S TG+ TRSKS +KRK V S SA V+ SS SDSE +V KK + E Sbjct: 106 -SKSTSLINKTSTGAYTRSKSLDKRKVVVASPSAFVEASSVSDSEVAVAKKAQQE 159