BLASTX nr result
ID: Ophiopogon26_contig00031586
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00031586 (478 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK60974.1| uncharacterized protein A4U43_C08F24680 [Asparagu... 55 9e-06 >gb|ONK60974.1| uncharacterized protein A4U43_C08F24680 [Asparagus officinalis] Length = 521 Score = 55.1 bits (131), Expect = 9e-06 Identities = 28/72 (38%), Positives = 39/72 (54%) Frame = -1 Query: 310 AHAVRGPGFVRAHAEEVRSFGMVPDAAIFPRAEARGGFLALLLSEVEVASAESLLERAVI 131 A GPGFVRAHA +V SF +P I +R GF + + ++ E L +A++ Sbjct: 302 AKGTPGPGFVRAHARDVESFARLPRTGINVIRGSRDGFPTFSIVQSDMPKVEGLYAKALV 361 Query: 130 VKFLSGRPKLEE 95 +KF GRP L E Sbjct: 362 MKFHGGRPSLAE 373