BLASTX nr result
ID: Ophiopogon26_contig00031505
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00031505 (412 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020253197.1| filament-like plant protein 3 [Asparagus off... 60 7e-08 >ref|XP_020253197.1| filament-like plant protein 3 [Asparagus officinalis] ref|XP_020253198.1| filament-like plant protein 3 [Asparagus officinalis] ref|XP_020253199.1| filament-like plant protein 3 [Asparagus officinalis] gb|ONK77509.1| uncharacterized protein A4U43_C02F7320 [Asparagus officinalis] Length = 705 Score = 60.5 bits (145), Expect = 7e-08 Identities = 29/46 (63%), Positives = 37/46 (80%) Frame = -2 Query: 162 EKEGLRASPNDSSPIYDSPNHTQSREISSISIENKVQETVKNLTEK 25 ++EGLRASP+DSSPI SPNH +S EIS + N++ ETVK+LTEK Sbjct: 36 DQEGLRASPSDSSPIDSSPNHAESAEISPNNRGNEIHETVKSLTEK 81