BLASTX nr result
ID: Ophiopogon26_contig00031432
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00031432 (470 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKA57040.1| Protein Mut11 [Apostasia shenzhenica] 67 7e-10 ref|XP_009396017.1| PREDICTED: COMPASS-like H3K4 histone methyla... 64 7e-09 ref|XP_008785689.1| PREDICTED: COMPASS-like H3K4 histone methyla... 61 5e-08 ref|XP_008790397.1| PREDICTED: COMPASS-like H3K4 histone methyla... 61 7e-08 gb|KMZ67861.1| WD repeat-containing protein [Zostera marina] 60 9e-08 ref|XP_010936247.1| PREDICTED: COMPASS-like H3K4 histone methyla... 60 9e-08 ref|XP_009389455.1| PREDICTED: COMPASS-like H3K4 histone methyla... 60 2e-07 ref|XP_010943189.1| PREDICTED: COMPASS-like H3K4 histone methyla... 60 2e-07 ref|XP_020704409.1| COMPASS-like H3K4 histone methylase componen... 59 3e-07 ref|XP_020701228.1| COMPASS-like H3K4 histone methylase componen... 58 6e-07 gb|PKU87350.1| Protein Mut11 [Dendrobium catenatum] 58 6e-07 ref|XP_002968271.1| hypothetical protein SELMODRAFT_169971 [Sela... 58 7e-07 gb|PIA55240.1| hypothetical protein AQUCO_00800161v1 [Aquilegia ... 58 8e-07 ref|XP_020593817.1| COMPASS-like H3K4 histone methylase componen... 58 8e-07 ref|XP_022133170.1| COMPASS-like H3K4 histone methylase componen... 57 1e-06 ref|XP_003382581.1| PREDICTED: WD repeat-containing protein 5-li... 57 2e-06 ref|XP_023893410.1| COMPASS-like H3K4 histone methylase componen... 57 2e-06 ref|XP_008787752.1| PREDICTED: COMPASS-like H3K4 histone methyla... 56 3e-06 ref|XP_021772268.1| COMPASS-like H3K4 histone methylase componen... 56 4e-06 ref|XP_004981923.1| COMPASS-like H3K4 histone methylase componen... 56 4e-06 >gb|PKA57040.1| Protein Mut11 [Apostasia shenzhenica] Length = 379 Score = 66.6 bits (161), Expect = 7e-10 Identities = 34/47 (72%), Positives = 39/47 (82%) Frame = +3 Query: 276 PKMSSPPPPHYLLHQTLIPHKRAISSVKFSPDGSLLASSSGDKTLRL 416 P +S+P Y+LHQTL HKRA+SSVKFSPDGSLLASSS DKTLR+ Sbjct: 68 PALSTP----YVLHQTLAGHKRAVSSVKFSPDGSLLASSSADKTLRV 110 >ref|XP_009396017.1| PREDICTED: COMPASS-like H3K4 histone methylase component WDR5A [Musa acuminata subsp. malaccensis] ref|XP_018680021.1| PREDICTED: COMPASS-like H3K4 histone methylase component WDR5A [Musa acuminata subsp. malaccensis] Length = 319 Score = 63.5 bits (153), Expect = 7e-09 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = +3 Query: 297 PPHYLLHQTLIPHKRAISSVKFSPDGSLLASSSGDKTLRL 416 P Y+LH+TL H RA+S+VKFSPDGSLLAS+SGDKTLR+ Sbjct: 11 PQPYVLHETLTSHNRAVSAVKFSPDGSLLASASGDKTLRV 50 >ref|XP_008785689.1| PREDICTED: COMPASS-like H3K4 histone methylase component WDR5A [Phoenix dactylifera] Length = 332 Score = 61.2 bits (147), Expect = 5e-08 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = +3 Query: 297 PPHYLLHQTLIPHKRAISSVKFSPDGSLLASSSGDKTLRL 416 P Y+L +TL HKRA+SSVKFSPDGSLLAS+S DKTLR+ Sbjct: 24 PQPYVLRETLTGHKRAVSSVKFSPDGSLLASASADKTLRI 63 >ref|XP_008790397.1| PREDICTED: COMPASS-like H3K4 histone methylase component WDR5A [Phoenix dactylifera] Length = 330 Score = 60.8 bits (146), Expect = 7e-08 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = +3 Query: 306 YLLHQTLIPHKRAISSVKFSPDGSLLASSSGDKTLRL 416 Y+L +TL+ HKRA+SSVKFSPDGSLLAS+S DKTLR+ Sbjct: 25 YVLRETLVGHKRAVSSVKFSPDGSLLASASADKTLRV 61 >gb|KMZ67861.1| WD repeat-containing protein [Zostera marina] Length = 328 Score = 60.5 bits (145), Expect = 9e-08 Identities = 26/39 (66%), Positives = 35/39 (89%) Frame = +3 Query: 300 PHYLLHQTLIPHKRAISSVKFSPDGSLLASSSGDKTLRL 416 P Y+LH+TL HKRA+SSV+FSPDG+L+AS+S DKT+R+ Sbjct: 26 PSYVLHRTLSGHKRAVSSVRFSPDGNLIASASADKTIRI 64 >ref|XP_010936247.1| PREDICTED: COMPASS-like H3K4 histone methylase component WDR5A [Elaeis guineensis] Length = 330 Score = 60.5 bits (145), Expect = 9e-08 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = +3 Query: 300 PHYLLHQTLIPHKRAISSVKFSPDGSLLASSSGDKTLRL 416 P Y++ +TL HKRA+SSVKFSPDGSLLAS+S DKTLR+ Sbjct: 23 PPYVIRETLAGHKRAVSSVKFSPDGSLLASASADKTLRV 61 >ref|XP_009389455.1| PREDICTED: COMPASS-like H3K4 histone methylase component WDR5A [Musa acuminata subsp. malaccensis] Length = 325 Score = 59.7 bits (143), Expect = 2e-07 Identities = 31/56 (55%), Positives = 40/56 (71%), Gaps = 8/56 (14%) Frame = +3 Query: 273 IPKMSSPPPPH--------YLLHQTLIPHKRAISSVKFSPDGSLLASSSGDKTLRL 416 +P+M+S PP Y+L QTL H+RA+S+VKFSPDGSLLAS+S DK LR+ Sbjct: 1 MPEMASAEPPSTAAALSQPYVLQQTLTGHERAVSAVKFSPDGSLLASASADKILRV 56 >ref|XP_010943189.1| PREDICTED: COMPASS-like H3K4 histone methylase component WDR5A [Elaeis guineensis] Length = 335 Score = 59.7 bits (143), Expect = 2e-07 Identities = 30/54 (55%), Positives = 38/54 (70%), Gaps = 2/54 (3%) Frame = +3 Query: 261 SPFKIPKMSSPPP--PHYLLHQTLIPHKRAISSVKFSPDGSLLASSSGDKTLRL 416 SPF P P Y+L +TL HKRA+S+V+FSPDG+LLAS+S DKTLR+ Sbjct: 10 SPFSAAAEGGSPTLSPPYVLRETLTGHKRAVSAVRFSPDGALLASASADKTLRI 63 >ref|XP_020704409.1| COMPASS-like H3K4 histone methylase component WDR5A [Dendrobium catenatum] gb|PKU65821.1| Protein Mut11 [Dendrobium catenatum] Length = 321 Score = 58.9 bits (141), Expect = 3e-07 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +3 Query: 306 YLLHQTLIPHKRAISSVKFSPDGSLLASSSGDKTLRL 416 Y LHQTL HKRA+SSVKFSP+GSLLAS+S +KT+R+ Sbjct: 16 YALHQTLTGHKRAVSSVKFSPEGSLLASASAEKTIRV 52 >ref|XP_020701228.1| COMPASS-like H3K4 histone methylase component WDR5A [Dendrobium catenatum] Length = 330 Score = 58.2 bits (139), Expect = 6e-07 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = +3 Query: 300 PHYLLHQTLIPHKRAISSVKFSPDGSLLASSSGDKTLRL 416 P Y+L +TL HKRAISSVKFSPDG+L+AS+S DKT+R+ Sbjct: 29 PPYILRETLRGHKRAISSVKFSPDGALIASASADKTVRV 67 >gb|PKU87350.1| Protein Mut11 [Dendrobium catenatum] Length = 365 Score = 58.2 bits (139), Expect = 6e-07 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = +3 Query: 300 PHYLLHQTLIPHKRAISSVKFSPDGSLLASSSGDKTLRL 416 P Y+L +TL HKRAISSVKFSPDG+L+AS+S DKT+R+ Sbjct: 64 PPYILRETLRGHKRAISSVKFSPDGALIASASADKTVRV 102 >ref|XP_002968271.1| hypothetical protein SELMODRAFT_169971 [Selaginella moellendorffii] ref|XP_002976105.1| hypothetical protein SELMODRAFT_443046 [Selaginella moellendorffii] gb|EFJ23010.1| hypothetical protein SELMODRAFT_443046 [Selaginella moellendorffii] gb|EFJ30525.1| hypothetical protein SELMODRAFT_169971 [Selaginella moellendorffii] Length = 312 Score = 57.8 bits (138), Expect = 7e-07 Identities = 28/44 (63%), Positives = 33/44 (75%) Frame = +3 Query: 285 SSPPPPHYLLHQTLIPHKRAISSVKFSPDGSLLASSSGDKTLRL 416 SSPP Y L TL H++A+SSVKFSPDG LL SSS DKT++L Sbjct: 7 SSPPYVPYALKMTLTGHQKAVSSVKFSPDGKLLGSSSADKTIKL 50 >gb|PIA55240.1| hypothetical protein AQUCO_00800161v1 [Aquilegia coerulea] Length = 320 Score = 57.8 bits (138), Expect = 8e-07 Identities = 31/49 (63%), Positives = 35/49 (71%) Frame = +3 Query: 270 KIPKMSSPPPPHYLLHQTLIPHKRAISSVKFSPDGSLLASSSGDKTLRL 416 + PK +PP Y L QTL HKR ISSVKFS DG+LL SSS DKT+RL Sbjct: 6 EFPKTLNPP---YKLKQTLTGHKRGISSVKFSDDGNLLGSSSADKTIRL 51 >ref|XP_020593817.1| COMPASS-like H3K4 histone methylase component WDR5A [Phalaenopsis equestris] Length = 331 Score = 57.8 bits (138), Expect = 8e-07 Identities = 27/39 (69%), Positives = 33/39 (84%) Frame = +3 Query: 300 PHYLLHQTLIPHKRAISSVKFSPDGSLLASSSGDKTLRL 416 P Y+L +TL HKRAISSVKFSPDG+L+ S+S DKTLR+ Sbjct: 30 PPYILRETLRGHKRAISSVKFSPDGALIVSASADKTLRV 68 >ref|XP_022133170.1| COMPASS-like H3K4 histone methylase component WDR5A [Momordica charantia] Length = 318 Score = 57.0 bits (136), Expect = 1e-06 Identities = 33/49 (67%), Positives = 33/49 (67%), Gaps = 5/49 (10%) Frame = +3 Query: 282 MSSPPPPH-----YLLHQTLIPHKRAISSVKFSPDGSLLASSSGDKTLR 413 MSS PP Y L QTL HKRAISSVKFS DG LL SSS DKTLR Sbjct: 1 MSSEPPQSEPYKPYTLSQTLTGHKRAISSVKFSADGRLLGSSSADKTLR 49 >ref|XP_003382581.1| PREDICTED: WD repeat-containing protein 5-like [Amphimedon queenslandica] Length = 343 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/48 (58%), Positives = 35/48 (72%) Frame = +3 Query: 273 IPKMSSPPPPHYLLHQTLIPHKRAISSVKFSPDGSLLASSSGDKTLRL 416 IP S P+Y L TL+ H +A+SSVKFSPDGS LASSS DKT+++ Sbjct: 33 IPSASKGNRPNYSLKFTLVGHTKAVSSVKFSPDGSWLASSSADKTVKI 80 >ref|XP_023893410.1| COMPASS-like H3K4 histone methylase component WDR5A [Quercus suber] gb|POE59766.1| compass-like h3k4 histone methylase component wdr5a [Quercus suber] Length = 324 Score = 56.6 bits (135), Expect = 2e-06 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = +3 Query: 306 YLLHQTLIPHKRAISSVKFSPDGSLLASSSGDKTLRL 416 Y L +TL PHKRAIS+VKFS DG LLASSS DKTLR+ Sbjct: 16 YTLAKTLTPHKRAISAVKFSSDGRLLASSSADKTLRI 52 >ref|XP_008787752.1| PREDICTED: COMPASS-like H3K4 histone methylase component WDR5A [Phoenix dactylifera] Length = 325 Score = 56.2 bits (134), Expect = 3e-06 Identities = 29/51 (56%), Positives = 37/51 (72%), Gaps = 7/51 (13%) Frame = +3 Query: 285 SSPPP-------PHYLLHQTLIPHKRAISSVKFSPDGSLLASSSGDKTLRL 416 SS PP P Y+L +TL HKRA+S+V FSPDG+LLAS+S DK+LR+ Sbjct: 3 SSAPPTGSPSFSPPYVLRETLTGHKRAVSAVMFSPDGALLASASADKSLRV 53 >ref|XP_021772268.1| COMPASS-like H3K4 histone methylase component WDR5A [Chenopodium quinoa] Length = 318 Score = 55.8 bits (133), Expect = 4e-06 Identities = 32/50 (64%), Positives = 34/50 (68%) Frame = +3 Query: 258 MSPFKIPKMSSPPPPHYLLHQTLIPHKRAISSVKFSPDGSLLASSSGDKT 407 MS P S P Y L QTLIPHKRAIS+VKFS DG LLASSS DK+ Sbjct: 1 MSSTTDPSQSFTP---YTLKQTLIPHKRAISAVKFSSDGRLLASSSADKS 47 >ref|XP_004981923.1| COMPASS-like H3K4 histone methylase component WDR5A [Setaria italica] gb|KQK87344.1| hypothetical protein SETIT_039077mg [Setaria italica] Length = 319 Score = 55.8 bits (133), Expect = 4e-06 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = +3 Query: 294 PPPHYLLHQTLIPHKRAISSVKFSPDGSLLASSSGDKTLRL 416 P P Y+L TL H+RA+S+VKFSPDG LLAS+S DK LR+ Sbjct: 11 PSPGYVLRSTLSGHRRAVSTVKFSPDGRLLASASADKLLRV 51