BLASTX nr result
ID: Ophiopogon26_contig00031124
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00031124 (438 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKA66487.1| hypothetical protein AXF42_Ash003141 [Apostasia s... 55 2e-06 >gb|PKA66487.1| hypothetical protein AXF42_Ash003141 [Apostasia shenzhenica] Length = 196 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/61 (37%), Positives = 37/61 (60%) Frame = +3 Query: 3 PKRFPIKILENLFAQCTSSYRVLRKIGSNTYELEIPRALSISQAFNGKDFTQYQAPVDFP 182 PKRFP ++++ L A +++L+K+GSNTY +++P IS FN D Y+ P P Sbjct: 6 PKRFPSRVVKKLQAHGAGPFKILKKLGSNTYVVDLPSDFGISTTFNISDLVAYKEPTAIP 65 Query: 183 T 185 + Sbjct: 66 S 66