BLASTX nr result
ID: Ophiopogon26_contig00030986
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00030986 (355 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK77375.1| uncharacterized protein A4U43_C02F5870 [Asparagus... 60 6e-08 ref|XP_020253770.1| zinc finger CCCH domain-containing protein 1... 60 7e-08 >gb|ONK77375.1| uncharacterized protein A4U43_C02F5870 [Asparagus officinalis] Length = 700 Score = 59.7 bits (143), Expect = 6e-08 Identities = 33/70 (47%), Positives = 41/70 (58%) Frame = -3 Query: 353 WETAQNDSVREETDGHVVEGRSRSHSEASKSYEKLKHYREKRKRELNNSDSDEMYDRRAR 174 WET S REET+ G S SH + SKS KLKH R+KR+ N+S SDE DR+ R Sbjct: 619 WETRGEASGREETEESSYNGSSSSHRKPSKSGGKLKHCRKKRRHVDNSSGSDEELDRKPR 678 Query: 173 NKFSRKQAST 144 K S Q ++ Sbjct: 679 KKHSHGQRTS 688 >ref|XP_020253770.1| zinc finger CCCH domain-containing protein 16 [Asparagus officinalis] Length = 725 Score = 59.7 bits (143), Expect = 7e-08 Identities = 33/70 (47%), Positives = 41/70 (58%) Frame = -3 Query: 353 WETAQNDSVREETDGHVVEGRSRSHSEASKSYEKLKHYREKRKRELNNSDSDEMYDRRAR 174 WET S REET+ G S SH + SKS KLKH R+KR+ N+S SDE DR+ R Sbjct: 644 WETRGEASGREETEESSYNGSSSSHRKPSKSGGKLKHCRKKRRHVDNSSGSDEELDRKPR 703 Query: 173 NKFSRKQAST 144 K S Q ++ Sbjct: 704 KKHSHGQRTS 713