BLASTX nr result
ID: Ophiopogon26_contig00030897
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00030897 (526 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020251080.1| uncharacterized protein LOC109828511 [Aspara... 56 5e-06 ref|XP_020251215.1| uncharacterized protein LOC109828682 [Aspara... 56 5e-06 >ref|XP_020251080.1| uncharacterized protein LOC109828511 [Asparagus officinalis] Length = 515 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/51 (50%), Positives = 32/51 (62%) Frame = +2 Query: 374 ATSRKDICVHGRSMEDNCKLSYISPSISSDGKYYAKILRSEIKETIAKWSN 526 +TS KDIC GR + NC L Y PS+ S+G YA I RSEI + KW+N Sbjct: 34 STSWKDICSMGREVNQNCSLQYFPPSVDSNGIQYASIPRSEILLNVDKWNN 84 >ref|XP_020251215.1| uncharacterized protein LOC109828682 [Asparagus officinalis] Length = 516 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/51 (50%), Positives = 32/51 (62%) Frame = +2 Query: 374 ATSRKDICVHGRSMEDNCKLSYISPSISSDGKYYAKILRSEIKETIAKWSN 526 +TS KDIC GR + NC L Y PS+ S+G YA I RSEI + KW+N Sbjct: 35 STSWKDICSMGREVNQNCSLQYFPPSVDSNGIQYASIPRSEILLNVDKWNN 85