BLASTX nr result
ID: Ophiopogon26_contig00030706
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00030706 (463 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003616777.1| hypothetical protein MTR_5g084150 [Medicago ... 88 1e-18 gb|AFK48586.1| unknown [Medicago truncatula] 57 1e-08 ref|NP_054927.1| hypothetical protein SpolCp017 (plastid) [Spina... 55 3e-07 emb|CAA25830.1| hypothetical protein, partial (chloroplast) [Pis... 52 5e-06 pir||T06501 hypothetical protein 59 - garden pea chloroplast 52 5e-06 ref|XP_021842836.1| uncharacterized protein LOC110782893 [Spinac... 46 8e-06 >ref|XP_003616777.1| hypothetical protein MTR_5g084150 [Medicago truncatula] gb|AES99735.1| hypothetical protein MTR_5g084150 [Medicago truncatula] Length = 187 Score = 87.8 bits (216), Expect = 1e-18 Identities = 48/88 (54%), Positives = 51/88 (57%), Gaps = 1/88 (1%) Frame = +2 Query: 203 FCRTNWLYYTHG-AVIFWAELDLNQRRHVANEFTVRPH*PLGHRPRKNSL*AY**SMINF 379 F T W+ HG +V FWAELDLNQRRH+ANEFT Sbjct: 5 FKNTKWVISLHGGSVNFWAELDLNQRRHIANEFT-------------------------- 38 Query: 380 LL*YPTPRGSRIPVASLKERCPKPLDDG 463 YPTPRGSRIPVASLKERCPKPLDDG Sbjct: 39 ---YPTPRGSRIPVASLKERCPKPLDDG 63 >gb|AFK48586.1| unknown [Medicago truncatula] Length = 29 Score = 57.4 bits (137), Expect = 1e-08 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -1 Query: 328 MPERLMGTDCKFVGDMSTLVQIQLGPK 248 MPERLMGTDCKFVG+MSTLVQIQLGPK Sbjct: 1 MPERLMGTDCKFVGNMSTLVQIQLGPK 27 >ref|NP_054927.1| hypothetical protein SpolCp017 (plastid) [Spinacia oleracea] emb|CAB88720.1| hypothetical protein (chloroplast) [Spinacia oleracea] Length = 83 Score = 55.5 bits (132), Expect = 3e-07 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = -1 Query: 328 MPERLMGTDCKFVGDMSTLVQIQLGP 251 MPERLMGTDCKFVG+MSTLVQIQLGP Sbjct: 1 MPERLMGTDCKFVGNMSTLVQIQLGP 26 >emb|CAA25830.1| hypothetical protein, partial (chloroplast) [Pisum sativum] Length = 62 Score = 51.6 bits (122), Expect = 5e-06 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = +2 Query: 248 FWAELDLNQRRHVANEFTVRPH 313 FWAELDLNQRRH+ANEFTVRPH Sbjct: 41 FWAELDLNQRRHIANEFTVRPH 62 >pir||T06501 hypothetical protein 59 - garden pea chloroplast Length = 62 Score = 51.6 bits (122), Expect = 5e-06 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = +2 Query: 248 FWAELDLNQRRHVANEFTVRPH 313 FWAELDLNQRRH+ANEFTVRPH Sbjct: 41 FWAELDLNQRRHIANEFTVRPH 62 >ref|XP_021842836.1| uncharacterized protein LOC110782893 [Spinacia oleracea] Length = 59 Score = 45.8 bits (107), Expect(3) = 8e-06 Identities = 20/22 (90%), Positives = 20/22 (90%) Frame = -3 Query: 461 HRLVV*DISLSRRQRGFDFPWG 396 HRL V DISLSRRQRGFDFPWG Sbjct: 10 HRLAVQDISLSRRQRGFDFPWG 31 Score = 27.3 bits (59), Expect(3) = 8e-06 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -2 Query: 348 NEFFLGRCPSG 316 N FFLGRCPSG Sbjct: 49 NRFFLGRCPSG 59 Score = 23.5 bits (49), Expect(3) = 8e-06 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -1 Query: 403 PGGRVLQKEVD 371 P GRVLQKEVD Sbjct: 29 PWGRVLQKEVD 39