BLASTX nr result
ID: Ophiopogon26_contig00030503
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00030503 (372 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020257950.1| methyltransferase-like protein 2 [Asparagus ... 59 1e-07 ref|XP_018679950.1| PREDICTED: methyltransferase-like protein 2 ... 54 6e-06 ref|XP_018679949.1| PREDICTED: methyltransferase-like protein 2 ... 54 6e-06 ref|XP_018679947.1| PREDICTED: methyltransferase-like protein 2 ... 54 6e-06 ref|XP_010943156.1| PREDICTED: methyltransferase-like protein 2 ... 54 8e-06 ref|XP_010943155.1| PREDICTED: methyltransferase-like protein 2 ... 54 8e-06 gb|PKA53630.1| Methyltransferase-like protein 2 [Apostasia shenz... 54 8e-06 >ref|XP_020257950.1| methyltransferase-like protein 2 [Asparagus officinalis] Length = 434 Score = 58.9 bits (141), Expect = 1e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +3 Query: 3 VKPDGSLIGELDLFHHRPYESLLIRYVDKKVS 98 VKPDGSLIGELDLFHHRPYESLL+ YV+ K + Sbjct: 325 VKPDGSLIGELDLFHHRPYESLLVGYVNTKTA 356 >ref|XP_018679950.1| PREDICTED: methyltransferase-like protein 2 isoform X3 [Musa acuminata subsp. malaccensis] Length = 388 Score = 54.3 bits (129), Expect = 6e-06 Identities = 23/28 (82%), Positives = 26/28 (92%) Frame = +3 Query: 3 VKPDGSLIGELDLFHHRPYESLLIRYVD 86 VKPDGSLIGELDLFHHRPYE LL+ Y++ Sbjct: 315 VKPDGSLIGELDLFHHRPYECLLLGYIN 342 >ref|XP_018679949.1| PREDICTED: methyltransferase-like protein 2 isoform X2 [Musa acuminata subsp. malaccensis] Length = 420 Score = 54.3 bits (129), Expect = 6e-06 Identities = 23/28 (82%), Positives = 26/28 (92%) Frame = +3 Query: 3 VKPDGSLIGELDLFHHRPYESLLIRYVD 86 VKPDGSLIGELDLFHHRPYE LL+ Y++ Sbjct: 309 VKPDGSLIGELDLFHHRPYECLLLGYIN 336 >ref|XP_018679947.1| PREDICTED: methyltransferase-like protein 2 isoform X1 [Musa acuminata subsp. malaccensis] ref|XP_018679948.1| PREDICTED: methyltransferase-like protein 2 isoform X1 [Musa acuminata subsp. malaccensis] Length = 426 Score = 54.3 bits (129), Expect = 6e-06 Identities = 23/28 (82%), Positives = 26/28 (92%) Frame = +3 Query: 3 VKPDGSLIGELDLFHHRPYESLLIRYVD 86 VKPDGSLIGELDLFHHRPYE LL+ Y++ Sbjct: 315 VKPDGSLIGELDLFHHRPYECLLLGYIN 342 >ref|XP_010943156.1| PREDICTED: methyltransferase-like protein 2 isoform X2 [Elaeis guineensis] Length = 422 Score = 53.9 bits (128), Expect = 8e-06 Identities = 23/28 (82%), Positives = 26/28 (92%) Frame = +3 Query: 3 VKPDGSLIGELDLFHHRPYESLLIRYVD 86 VKPDGSLIGELDLFHHRPYE LL+ Y++ Sbjct: 308 VKPDGSLIGELDLFHHRPYEYLLLGYIN 335 >ref|XP_010943155.1| PREDICTED: methyltransferase-like protein 2 isoform X1 [Elaeis guineensis] Length = 423 Score = 53.9 bits (128), Expect = 8e-06 Identities = 23/28 (82%), Positives = 26/28 (92%) Frame = +3 Query: 3 VKPDGSLIGELDLFHHRPYESLLIRYVD 86 VKPDGSLIGELDLFHHRPYE LL+ Y++ Sbjct: 309 VKPDGSLIGELDLFHHRPYEYLLLGYIN 336 >gb|PKA53630.1| Methyltransferase-like protein 2 [Apostasia shenzhenica] Length = 424 Score = 53.9 bits (128), Expect = 8e-06 Identities = 24/38 (63%), Positives = 30/38 (78%) Frame = +3 Query: 3 VKPDGSLIGELDLFHHRPYESLLIRYVDKKVSLLPGRL 116 VKP+GSL+G+LDLFHHRPYE LLI YV+ K + R+ Sbjct: 313 VKPNGSLLGQLDLFHHRPYEHLLIGYVEPKKTAPESRM 350