BLASTX nr result
ID: Ophiopogon26_contig00030434
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00030434 (489 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020242537.1| (3S,6E)-nerolidol synthase 1-like [Asparagus... 67 1e-11 ref|XP_020093231.1| (3S,6E)-nerolidol synthase 1-like [Ananas co... 45 1e-06 gb|OAY74871.1| (3S,6E)-nerolidol synthase 2, chloroplastic/mitoc... 45 4e-06 >ref|XP_020242537.1| (3S,6E)-nerolidol synthase 1-like [Asparagus officinalis] Length = 588 Score = 67.0 bits (162), Expect(2) = 1e-11 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = +3 Query: 291 MLTKFTNKKGRFK*TLRRDVKGLLSLYEASYLNTGENVLD 410 +LTKFT+KKGRFK +LR DV+GLLSLYEASYLNTGE +LD Sbjct: 169 VLTKFTDKKGRFKSSLRGDVQGLLSLYEASYLNTGEEILD 208 Score = 30.0 bits (66), Expect(2) = 1e-11 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = +1 Query: 148 FEVTLSFCLLRQAGYPISS 204 FE LSF LLRQAG+PI S Sbjct: 149 FETALSFRLLRQAGHPICS 167 >ref|XP_020093231.1| (3S,6E)-nerolidol synthase 1-like [Ananas comosus] Length = 555 Score = 45.4 bits (106), Expect(2) = 1e-06 Identities = 18/41 (43%), Positives = 34/41 (82%) Frame = +3 Query: 291 MLTKFTNKKGRFK*TLRRDVKGLLSLYEASYLNTGENVLDK 413 +L F ++KG F+ +L +D++G++SL+++S+LNTGE++L K Sbjct: 135 ILDCFVDEKGEFRSSLSKDIRGMMSLHDSSHLNTGEDILYK 175 Score = 34.7 bits (78), Expect(2) = 1e-06 Identities = 19/32 (59%), Positives = 23/32 (71%), Gaps = 5/32 (15%) Frame = +1 Query: 124 YVNSANMH-----FEVTLSFCLLRQAGYPISS 204 Y + +N+H FEVTLSF LLRQAGY +SS Sbjct: 102 YEDLSNVHKRGDLFEVTLSFRLLRQAGYYVSS 133 >gb|OAY74871.1| (3S,6E)-nerolidol synthase 2, chloroplastic/mitochondrial, partial [Ananas comosus] Length = 319 Score = 45.1 bits (105), Expect(2) = 4e-06 Identities = 17/37 (45%), Positives = 32/37 (86%) Frame = +3 Query: 303 FTNKKGRFK*TLRRDVKGLLSLYEASYLNTGENVLDK 413 F ++KG F+ +L +D++G++SL+++S+LNTGE++L K Sbjct: 89 FVDEKGEFRSSLSKDIRGMMSLHDSSHLNTGEDILYK 125 Score = 33.1 bits (74), Expect(2) = 4e-06 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = +1 Query: 148 FEVTLSFCLLRQAGYPISS 204 FEVTLSF LLRQAGY +SS Sbjct: 68 FEVTLSFRLLRQAGYYVSS 86