BLASTX nr result
ID: Ophiopogon26_contig00030107
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00030107 (360 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020275536.1| uncharacterized protein LOC109850045 [Aspara... 54 6e-07 gb|ONK63939.1| uncharacterized protein A4U43_C07F20470 [Asparagu... 54 9e-07 >ref|XP_020275536.1| uncharacterized protein LOC109850045 [Asparagus officinalis] Length = 115 Score = 54.3 bits (129), Expect = 6e-07 Identities = 26/37 (70%), Positives = 32/37 (86%), Gaps = 3/37 (8%) Frame = -3 Query: 103 MAMDGYVDD---MMCEGLFDNIDDLLDFSTDDEVLGM 2 MA + YVD+ MMCEGLFDNI+DLLDFS+DDE+LG+ Sbjct: 1 MASNVYVDEKLEMMCEGLFDNIEDLLDFSSDDELLGI 37 >gb|ONK63939.1| uncharacterized protein A4U43_C07F20470 [Asparagus officinalis] Length = 137 Score = 54.3 bits (129), Expect = 9e-07 Identities = 26/37 (70%), Positives = 32/37 (86%), Gaps = 3/37 (8%) Frame = -3 Query: 103 MAMDGYVDD---MMCEGLFDNIDDLLDFSTDDEVLGM 2 MA + YVD+ MMCEGLFDNI+DLLDFS+DDE+LG+ Sbjct: 23 MASNVYVDEKLEMMCEGLFDNIEDLLDFSSDDELLGI 59