BLASTX nr result
ID: Ophiopogon26_contig00030106
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00030106 (380 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008782411.2| PREDICTED: LOW QUALITY PROTEIN: paired amphi... 56 1e-06 >ref|XP_008782411.2| PREDICTED: LOW QUALITY PROTEIN: paired amphipathic helix protein Sin3-like 4 [Phoenix dactylifera] Length = 1441 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 99 LKRVKEEGLMGSQLKRPNVSRADPSGQSHMA 7 +KR +EE MGSQLKRPNVSRADPSGQ+HMA Sbjct: 1 MKRAREEAFMGSQLKRPNVSRADPSGQTHMA 31