BLASTX nr result
ID: Ophiopogon26_contig00030086
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00030086 (387 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020246094.1| arabinosyltransferase RRA2-like [Asparagus o... 59 2e-07 ref|XP_020218241.1| arabinosyltransferase RRA3-like [Cajanus caj... 58 3e-07 ref|XP_021896524.1| arabinosyltransferase RRA3-like [Carica papaya] 57 6e-07 ref|XP_011074516.1| arabinosyltransferase RRA3-like [Sesamum ind... 57 6e-07 ref|XP_023891612.1| arabinosyltransferase RRA3-like [Quercus sub... 57 6e-07 ref|XP_008447051.1| PREDICTED: arabinosyltransferase RRA3-like [... 56 1e-06 gb|PIA52543.1| hypothetical protein AQUCO_01000429v1 [Aquilegia ... 56 2e-06 emb|CBI19661.3| unnamed protein product, partial [Vitis vinifera] 56 2e-06 gb|PRQ27002.1| putative nucleotide-diphospho-sugar transferase [... 55 3e-06 ref|XP_021285203.1| arabinosyltransferase RRA3-like [Herrania um... 55 3e-06 ref|XP_024166385.1| arabinosyltransferase RRA3-like [Rosa chinen... 55 3e-06 ref|XP_004148298.1| PREDICTED: UDP-D-xylose:L-fucose alpha-1,3-D... 55 3e-06 ref|XP_023554084.1| arabinosyltransferase RRA3-like [Cucurbita p... 55 3e-06 ref|XP_022972349.1| arabinosyltransferase RRA3-like [Cucurbita m... 55 3e-06 ref|XP_022952980.1| arabinosyltransferase RRA3-like [Cucurbita m... 55 3e-06 gb|OMO87626.1| Reticulon [Corchorus capsularis] 55 4e-06 gb|OMO75039.1| Reticulon [Corchorus olitorius] 55 4e-06 ref|XP_002283221.1| PREDICTED: arabinosyltransferase RRA3 [Vitis... 55 4e-06 ref|XP_004291893.1| PREDICTED: uncharacterized protein LOC101304... 55 5e-06 ref|XP_012071801.1| arabinosyltransferase RRA3 [Jatropha curcas]... 54 7e-06 >ref|XP_020246094.1| arabinosyltransferase RRA2-like [Asparagus officinalis] gb|ONK58599.1| uncharacterized protein A4U43_C09F14720 [Asparagus officinalis] Length = 432 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -3 Query: 385 KFFRMKAVVEFYVNGKQDALEPLPDGSEW 299 K FRMKAVVEFYVNGKQDAL+P PDGS+W Sbjct: 404 KLFRMKAVVEFYVNGKQDALDPFPDGSDW 432 >ref|XP_020218241.1| arabinosyltransferase RRA3-like [Cajanus cajan] gb|KYP66056.1| hypothetical protein KK1_012338 [Cajanus cajan] Length = 461 Score = 58.2 bits (139), Expect = 3e-07 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -3 Query: 385 KFFRMKAVVEFYVNGKQDALEPLPDGSEW*FFYCSR 278 K RMKA+VE+Y+NGKQDAL+P PDGSEW +CSR Sbjct: 411 KLPRMKAIVEYYINGKQDALKPFPDGSEWYPCFCSR 446 >ref|XP_021896524.1| arabinosyltransferase RRA3-like [Carica papaya] Length = 428 Score = 57.4 bits (137), Expect = 6e-07 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -3 Query: 385 KFFRMKAVVEFYVNGKQDALEPLPDGSEW 299 KF RMKAVVEFYVNGKQDAL+P PDGS+W Sbjct: 400 KFPRMKAVVEFYVNGKQDALDPFPDGSDW 428 >ref|XP_011074516.1| arabinosyltransferase RRA3-like [Sesamum indicum] Length = 432 Score = 57.4 bits (137), Expect = 6e-07 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -3 Query: 385 KFFRMKAVVEFYVNGKQDALEPLPDGSEW 299 K RMKAVVEFYVNGKQDALEP PDGSEW Sbjct: 403 KLPRMKAVVEFYVNGKQDALEPFPDGSEW 431 >ref|XP_023891612.1| arabinosyltransferase RRA3-like [Quercus suber] ref|XP_023900303.1| arabinosyltransferase RRA3-like [Quercus suber] gb|POE50845.1| arabinosyltransferase rra3 [Quercus suber] gb|POE61747.1| arabinosyltransferase rra3 [Quercus suber] Length = 435 Score = 57.4 bits (137), Expect = 6e-07 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = -3 Query: 385 KFFRMKAVVEFYVNGKQDALEPLPDGSEW 299 K RMKAVVEFYVNGKQDALEP P+GSEW Sbjct: 407 KLLRMKAVVEFYVNGKQDALEPFPEGSEW 435 >ref|XP_008447051.1| PREDICTED: arabinosyltransferase RRA3-like [Cucumis melo] Length = 435 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = -3 Query: 385 KFFRMKAVVEFYVNGKQDALEPLPDGSEW 299 KF RMKAVV+FYVNGKQDAL+P PDGS+W Sbjct: 407 KFPRMKAVVDFYVNGKQDALDPFPDGSDW 435 >gb|PIA52543.1| hypothetical protein AQUCO_01000429v1 [Aquilegia coerulea] Length = 433 Score = 55.8 bits (133), Expect = 2e-06 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = -3 Query: 385 KFFRMKAVVEFYVNGKQDALEPLPDGSEW 299 K RMKAVVEFYVNGKQDAL+P PDGSEW Sbjct: 405 KLPRMKAVVEFYVNGKQDALKPFPDGSEW 433 >emb|CBI19661.3| unnamed protein product, partial [Vitis vinifera] Length = 446 Score = 55.8 bits (133), Expect = 2e-06 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -3 Query: 385 KFFRMKAVVEFYVNGKQDALEPLPDGSEW*F 293 K RMKAVVEFYVNGKQDAL+P PDGS W F Sbjct: 406 KLSRMKAVVEFYVNGKQDALDPFPDGSNWYF 436 >gb|PRQ27002.1| putative nucleotide-diphospho-sugar transferase [Rosa chinensis] Length = 415 Score = 55.5 bits (132), Expect = 3e-06 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = -3 Query: 385 KFFRMKAVVEFYVNGKQDALEPLPDGSEW 299 K RMKA+VEFY+NGKQDALEP PDGS+W Sbjct: 387 KLPRMKAIVEFYINGKQDALEPFPDGSDW 415 >ref|XP_021285203.1| arabinosyltransferase RRA3-like [Herrania umbratica] Length = 428 Score = 55.5 bits (132), Expect = 3e-06 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = -3 Query: 385 KFFRMKAVVEFYVNGKQDALEPLPDGSEW 299 K RMKAVVEFYVNGKQDAL+P PDGS+W Sbjct: 400 KLRRMKAVVEFYVNGKQDALDPFPDGSDW 428 >ref|XP_024166385.1| arabinosyltransferase RRA3-like [Rosa chinensis] Length = 432 Score = 55.5 bits (132), Expect = 3e-06 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = -3 Query: 385 KFFRMKAVVEFYVNGKQDALEPLPDGSEW 299 K RMKA+VEFY+NGKQDALEP PDGS+W Sbjct: 404 KLPRMKAIVEFYINGKQDALEPFPDGSDW 432 >ref|XP_004148298.1| PREDICTED: UDP-D-xylose:L-fucose alpha-1,3-D-xylosyltransferase 2-like [Cucumis sativus] gb|KGN44320.1| hypothetical protein Csa_7G253750 [Cucumis sativus] Length = 435 Score = 55.5 bits (132), Expect = 3e-06 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = -3 Query: 385 KFFRMKAVVEFYVNGKQDALEPLPDGSEW 299 KF RMKAVV+FYVNGKQDAL P PDGS+W Sbjct: 407 KFPRMKAVVDFYVNGKQDALNPFPDGSDW 435 >ref|XP_023554084.1| arabinosyltransferase RRA3-like [Cucurbita pepo subsp. pepo] Length = 437 Score = 55.5 bits (132), Expect = 3e-06 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = -3 Query: 385 KFFRMKAVVEFYVNGKQDALEPLPDGSEW 299 KF RMKAVV+FYVNGKQDAL P PDGS+W Sbjct: 409 KFPRMKAVVDFYVNGKQDALNPFPDGSDW 437 >ref|XP_022972349.1| arabinosyltransferase RRA3-like [Cucurbita maxima] Length = 443 Score = 55.5 bits (132), Expect = 3e-06 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = -3 Query: 385 KFFRMKAVVEFYVNGKQDALEPLPDGSEW 299 KF RMKAVV+FYVNGKQDAL P PDGS+W Sbjct: 409 KFPRMKAVVDFYVNGKQDALNPFPDGSDW 437 >ref|XP_022952980.1| arabinosyltransferase RRA3-like [Cucurbita moschata] Length = 443 Score = 55.5 bits (132), Expect = 3e-06 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = -3 Query: 385 KFFRMKAVVEFYVNGKQDALEPLPDGSEW 299 KF RMKAVV+FYVNGKQDAL P PDGS+W Sbjct: 409 KFPRMKAVVDFYVNGKQDALNPFPDGSDW 437 >gb|OMO87626.1| Reticulon [Corchorus capsularis] Length = 428 Score = 55.1 bits (131), Expect = 4e-06 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = -3 Query: 385 KFFRMKAVVEFYVNGKQDALEPLPDGSEW 299 K RMKAV+EFYVNGKQDAL+P PDGS+W Sbjct: 400 KLRRMKAVIEFYVNGKQDALDPFPDGSDW 428 >gb|OMO75039.1| Reticulon [Corchorus olitorius] Length = 428 Score = 55.1 bits (131), Expect = 4e-06 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = -3 Query: 385 KFFRMKAVVEFYVNGKQDALEPLPDGSEW 299 K RMKAV+EFYVNGKQDAL+P PDGS+W Sbjct: 400 KLRRMKAVIEFYVNGKQDALDPFPDGSDW 428 >ref|XP_002283221.1| PREDICTED: arabinosyltransferase RRA3 [Vitis vinifera] Length = 434 Score = 55.1 bits (131), Expect = 4e-06 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = -3 Query: 385 KFFRMKAVVEFYVNGKQDALEPLPDGSEW 299 K RMKAVVEFYVNGKQDAL+P PDGS W Sbjct: 406 KLSRMKAVVEFYVNGKQDALDPFPDGSNW 434 >ref|XP_004291893.1| PREDICTED: uncharacterized protein LOC101304249 [Fragaria vesca subsp. vesca] Length = 437 Score = 54.7 bits (130), Expect = 5e-06 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = -3 Query: 385 KFFRMKAVVEFYVNGKQDALEPLPDGSEW 299 K RMKA+VEFY+NGKQDALEP PDGS W Sbjct: 409 KLPRMKAIVEFYINGKQDALEPFPDGSNW 437 >ref|XP_012071801.1| arabinosyltransferase RRA3 [Jatropha curcas] gb|KDP38476.1| hypothetical protein JCGZ_04401 [Jatropha curcas] Length = 429 Score = 54.3 bits (129), Expect = 7e-06 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = -3 Query: 385 KFFRMKAVVEFYVNGKQDALEPLPDGSE 302 KF RMKAVVEFYVNGKQDALEP PDGS+ Sbjct: 402 KFPRMKAVVEFYVNGKQDALEPFPDGSD 429