BLASTX nr result
ID: Ophiopogon26_contig00030058
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00030058 (460 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX68684.1| hypothetical protein RirG_102910 [Rhizophagus irr... 118 3e-32 >gb|EXX68684.1| hypothetical protein RirG_102910 [Rhizophagus irregularis DAOM 197198w] gb|PKC04450.1| putative stress-associated endoplasmic reticulum protein [Rhizophagus irregularis] gb|PKC60518.1| putative stress-associated endoplasmic reticulum protein [Rhizophagus irregularis] gb|PKK72138.1| putative stress-associated endoplasmic reticulum protein [Rhizophagus irregularis] gb|PKY22839.1| putative stress-associated endoplasmic reticulum protein [Rhizophagus irregularis] gb|PKY39263.1| putative stress-associated endoplasmic reticulum protein [Rhizophagus irregularis] gb|POG65308.1| hypothetical protein GLOIN_2v1667611 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 61 Score = 118 bits (296), Expect = 3e-32 Identities = 60/61 (98%), Positives = 60/61 (98%) Frame = -1 Query: 391 MPGTTNPVIRAKNKAYLSNTTSRTHSLKKTKEDKIPVSQVTLGIILFVVIGSAIFEILKY 212 MPGTTNPVIRAKNKAYLSNT SRTHSLKKTKEDKIPVSQVTLGIILFVVIGSAIFEILKY Sbjct: 1 MPGTTNPVIRAKNKAYLSNTNSRTHSLKKTKEDKIPVSQVTLGIILFVVIGSAIFEILKY 60 Query: 211 I 209 I Sbjct: 61 I 61