BLASTX nr result
ID: Ophiopogon26_contig00030037
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00030037 (899 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020271186.1| kinesin-like protein KIN-12C [Asparagus offi... 59 6e-06 >ref|XP_020271186.1| kinesin-like protein KIN-12C [Asparagus officinalis] Length = 1402 Score = 58.9 bits (141), Expect = 6e-06 Identities = 28/45 (62%), Positives = 35/45 (77%) Frame = +2 Query: 5 IGSQQVQSIRQTIQVPQQVEVDATPHGVEVTPHSPDCSVSFGMPT 139 I SQQV+S Q I+V QQV+ D+T H VE+TPH+PD SV FG+PT Sbjct: 125 IDSQQVESFGQIIEVSQQVKSDSTSHWVELTPHTPDYSVLFGIPT 169