BLASTX nr result
ID: Ophiopogon26_contig00029889
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00029889 (431 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020259550.1| serine/threonine-protein phosphatase 7 long ... 55 1e-06 ref|XP_020263530.1| uncharacterized protein LOC109839491 [Aspara... 54 5e-06 >ref|XP_020259550.1| serine/threonine-protein phosphatase 7 long form homolog [Asparagus officinalis] Length = 145 Score = 54.7 bits (130), Expect = 1e-06 Identities = 22/34 (64%), Positives = 25/34 (73%) Frame = -3 Query: 411 YLYWYWGITRRWIFTPTDPPITYAPRGYLEREMV 310 YL+WYWGITRRWIF P Y PRG +ERE+V Sbjct: 110 YLWWYWGITRRWIFQENKAPKEYIPRGPVERELV 143 >ref|XP_020263530.1| uncharacterized protein LOC109839491 [Asparagus officinalis] Length = 179 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/34 (64%), Positives = 24/34 (70%) Frame = -3 Query: 411 YLYWYWGITRRWIFTPTDPPITYAPRGYLEREMV 310 YL WYWGITRRWIF P Y PRG +ERE+V Sbjct: 67 YLRWYWGITRRWIFQENKAPKEYIPRGLVERELV 100