BLASTX nr result
ID: Ophiopogon26_contig00029577
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00029577 (399 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020262345.1| thaumatin-like protein 1b [Asparagus officin... 56 2e-06 >ref|XP_020262345.1| thaumatin-like protein 1b [Asparagus officinalis] Length = 325 Score = 55.8 bits (133), Expect = 2e-06 Identities = 32/58 (55%), Positives = 38/58 (65%), Gaps = 7/58 (12%) Frame = +1 Query: 37 PQVAMPLINGTMVFLSGDEVS----YSGASFR---SGPNGVWPVLIGLTWMLLRNGAH 189 PQ A+PLIN TMVFL GD+V G+S R + P +WPV IGLTW L+R GAH Sbjct: 269 PQAALPLINSTMVFLGGDDVPAPPLIGGSSPRAQVASPFVLWPVAIGLTWFLIR-GAH 325