BLASTX nr result
ID: Ophiopogon26_contig00029284
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00029284 (498 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020256678.1| peroxidase 7 isoform X4 [Asparagus officinal... 74 3e-12 ref|XP_020256677.1| peroxidase 7 isoform X3 [Asparagus officinalis] 74 3e-12 ref|XP_020256674.1| peroxidase 7 isoform X2 [Asparagus officinal... 74 3e-12 ref|XP_020256679.1| peroxidase 7 isoform X5 [Asparagus officinalis] 70 6e-11 >ref|XP_020256678.1| peroxidase 7 isoform X4 [Asparagus officinalis] gb|ONK74872.1| uncharacterized protein A4U43_C03F10990 [Asparagus officinalis] Length = 335 Score = 73.6 bits (179), Expect = 3e-12 Identities = 34/51 (66%), Positives = 39/51 (76%), Gaps = 1/51 (1%) Frame = +1 Query: 349 FIMAMGGIPSLPKQVPKLLAGAD-DLTFNHYARTCPNFEAVVHKKVKQWIA 498 FIMAMGG+P Q P ++ D DLTFNHYARTCPNFEA+VH KVK WI+ Sbjct: 17 FIMAMGGVPYHKYQEPGTISDTDEDLTFNHYARTCPNFEAIVHNKVKDWIS 67 >ref|XP_020256677.1| peroxidase 7 isoform X3 [Asparagus officinalis] Length = 384 Score = 73.6 bits (179), Expect = 3e-12 Identities = 34/51 (66%), Positives = 39/51 (76%), Gaps = 1/51 (1%) Frame = +1 Query: 349 FIMAMGGIPSLPKQVPKLLAGAD-DLTFNHYARTCPNFEAVVHKKVKQWIA 498 FIMAMGG+P Q P ++ D DLTFNHYARTCPNFEA+VH KVK WI+ Sbjct: 66 FIMAMGGVPYHKYQEPGTISDTDEDLTFNHYARTCPNFEAIVHNKVKDWIS 116 >ref|XP_020256674.1| peroxidase 7 isoform X2 [Asparagus officinalis] ref|XP_020256675.1| peroxidase 7 isoform X2 [Asparagus officinalis] ref|XP_020256676.1| peroxidase 7 isoform X2 [Asparagus officinalis] Length = 391 Score = 73.6 bits (179), Expect = 3e-12 Identities = 34/51 (66%), Positives = 39/51 (76%), Gaps = 1/51 (1%) Frame = +1 Query: 349 FIMAMGGIPSLPKQVPKLLAGAD-DLTFNHYARTCPNFEAVVHKKVKQWIA 498 FIMAMGG+P Q P ++ D DLTFNHYARTCPNFEA+VH KVK WI+ Sbjct: 73 FIMAMGGVPYHKYQEPGTISDTDEDLTFNHYARTCPNFEAIVHNKVKDWIS 123 >ref|XP_020256679.1| peroxidase 7 isoform X5 [Asparagus officinalis] Length = 317 Score = 69.7 bits (169), Expect = 6e-11 Identities = 32/49 (65%), Positives = 37/49 (75%), Gaps = 1/49 (2%) Frame = +1 Query: 355 MAMGGIPSLPKQVPKLLAGAD-DLTFNHYARTCPNFEAVVHKKVKQWIA 498 MAMGG+P Q P ++ D DLTFNHYARTCPNFEA+VH KVK WI+ Sbjct: 1 MAMGGVPYHKYQEPGTISDTDEDLTFNHYARTCPNFEAIVHNKVKDWIS 49