BLASTX nr result
ID: Ophiopogon26_contig00029191
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00029191 (647 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020275536.1| uncharacterized protein LOC109850045 [Aspara... 58 2e-07 gb|ONK63939.1| uncharacterized protein A4U43_C07F20470 [Asparagu... 58 4e-07 >ref|XP_020275536.1| uncharacterized protein LOC109850045 [Asparagus officinalis] Length = 115 Score = 57.8 bits (138), Expect = 2e-07 Identities = 28/47 (59%), Positives = 36/47 (76%), Gaps = 1/47 (2%) Frame = -1 Query: 584 SFPSSDGEVCRVSATSDETKICDEVNIDEDWITNFLDDSNFDID-FP 447 SFP+S GE RV+ S+E K+C+E+ +DWITNFLDDSNF +D FP Sbjct: 56 SFPNS-GEGSRVTTASEENKVCEEIEGVDDWITNFLDDSNFKLDCFP 101 >gb|ONK63939.1| uncharacterized protein A4U43_C07F20470 [Asparagus officinalis] Length = 137 Score = 57.8 bits (138), Expect = 4e-07 Identities = 28/47 (59%), Positives = 36/47 (76%), Gaps = 1/47 (2%) Frame = -1 Query: 584 SFPSSDGEVCRVSATSDETKICDEVNIDEDWITNFLDDSNFDID-FP 447 SFP+S GE RV+ S+E K+C+E+ +DWITNFLDDSNF +D FP Sbjct: 78 SFPNS-GEGSRVTTASEENKVCEEIEGVDDWITNFLDDSNFKLDCFP 123