BLASTX nr result
ID: Ophiopogon26_contig00029024
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00029024 (774 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020270460.1| probable sodium-coupled neutral amino acid t... 60 8e-07 ref|XP_020265673.1| probable sodium-coupled neutral amino acid t... 57 9e-06 >ref|XP_020270460.1| probable sodium-coupled neutral amino acid transporter 6 [Asparagus officinalis] gb|ONK78922.1| uncharacterized protein A4U43_C01F1030 [Asparagus officinalis] Length = 479 Score = 60.5 bits (145), Expect = 8e-07 Identities = 33/54 (61%), Positives = 38/54 (70%), Gaps = 3/54 (5%) Frame = +3 Query: 621 MNGNYAVVPANSSVELQHQNNAASADGSKNRPQ--EFF-AEEYTDEFDEIDDLP 773 MN NYA VP NSS+ELQ+QNNA SA+ + Q EF EYTD FDEID+LP Sbjct: 1 MNSNYAAVPVNSSIELQNQNNANSAETPNGKVQSTEFTGGGEYTDGFDEIDELP 54 >ref|XP_020265673.1| probable sodium-coupled neutral amino acid transporter 6 [Asparagus officinalis] gb|ONK70392.1| uncharacterized protein A4U43_C05F33240 [Asparagus officinalis] Length = 479 Score = 57.4 bits (137), Expect = 9e-06 Identities = 30/53 (56%), Positives = 38/53 (71%), Gaps = 2/53 (3%) Frame = +3 Query: 621 MNGNYAVVPANSSVELQHQNNAASAD--GSKNRPQEFFAEEYTDEFDEIDDLP 773 MN +YAV+P NSSVELQ+QNNAAS + K + +EF E+ DE DEID +P Sbjct: 1 MNSDYAVIPVNSSVELQNQNNAASLEIPNPKIQSKEFPGEQNIDESDEIDGVP 53