BLASTX nr result
ID: Ophiopogon26_contig00028735
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00028735 (1262 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKC70229.1| hypothetical protein RhiirA1_439542, partial [Rhi... 67 6e-10 gb|PKY16063.1| hypothetical protein RhiirB3_479909 [Rhizophagus ... 67 2e-08 gb|EXX53293.1| hypothetical protein RirG_245330 [Rhizophagus irr... 67 2e-08 gb|PKK66476.1| hypothetical protein RhiirC2_699866 [Rhizophagus ... 67 2e-08 >gb|PKC70229.1| hypothetical protein RhiirA1_439542, partial [Rhizophagus irregularis] Length = 106 Score = 66.6 bits (161), Expect = 6e-10 Identities = 33/35 (94%), Positives = 33/35 (94%), Gaps = 1/35 (2%) Frame = -3 Query: 105 MHLKYLLLMIFAFGSART-LAFPLDKRCGGYKRDA 4 MHLKYLLLMIFAFGSAR LAFPLDKRCGGYKRDA Sbjct: 1 MHLKYLLLMIFAFGSARMILAFPLDKRCGGYKRDA 35 >gb|PKY16063.1| hypothetical protein RhiirB3_479909 [Rhizophagus irregularis] Length = 287 Score = 66.6 bits (161), Expect = 2e-08 Identities = 33/35 (94%), Positives = 33/35 (94%), Gaps = 1/35 (2%) Frame = -3 Query: 105 MHLKYLLLMIFAFGSART-LAFPLDKRCGGYKRDA 4 MHLKYLLLMIFAFGSAR LAFPLDKRCGGYKRDA Sbjct: 1 MHLKYLLLMIFAFGSARMILAFPLDKRCGGYKRDA 35 >gb|EXX53293.1| hypothetical protein RirG_245330 [Rhizophagus irregularis DAOM 197198w] Length = 333 Score = 66.6 bits (161), Expect = 2e-08 Identities = 33/35 (94%), Positives = 33/35 (94%), Gaps = 1/35 (2%) Frame = -3 Query: 105 MHLKYLLLMIFAFGSART-LAFPLDKRCGGYKRDA 4 MHLKYLLLMIFAFGSAR LAFPLDKRCGGYKRDA Sbjct: 1 MHLKYLLLMIFAFGSARMILAFPLDKRCGGYKRDA 35 >gb|PKK66476.1| hypothetical protein RhiirC2_699866 [Rhizophagus irregularis] Length = 345 Score = 66.6 bits (161), Expect = 2e-08 Identities = 33/35 (94%), Positives = 33/35 (94%), Gaps = 1/35 (2%) Frame = -3 Query: 105 MHLKYLLLMIFAFGSART-LAFPLDKRCGGYKRDA 4 MHLKYLLLMIFAFGSAR LAFPLDKRCGGYKRDA Sbjct: 1 MHLKYLLLMIFAFGSARMILAFPLDKRCGGYKRDA 35