BLASTX nr result
ID: Ophiopogon26_contig00028285
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00028285 (522 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006382208.1| hypothetical protein POPTR_0006s29380g, part... 57 1e-09 ref|XP_018680191.1| PREDICTED: U-box domain-containing protein 5... 50 5e-09 ref|XP_009398618.1| PREDICTED: U-box domain-containing protein 5... 51 6e-09 ref|XP_009398619.1| PREDICTED: U-box domain-containing protein 5... 51 6e-09 ref|XP_018679849.1| PREDICTED: U-box domain-containing protein 5... 51 6e-09 ref|XP_007160217.1| hypothetical protein PHAVU_002G302700g [Phas... 57 2e-08 gb|ONK70170.1| uncharacterized protein A4U43_C05F30990 [Asparagu... 62 6e-08 gb|OWM69481.1| hypothetical protein CDL15_Pgr013942 [Punica gran... 53 4e-07 gb|PKI38204.1| hypothetical protein CRG98_041457, partial [Punic... 53 4e-07 gb|KGN61212.1| hypothetical protein Csa_2G070290 [Cucumis sativus] 59 6e-07 ref|XP_022997318.1| U-box domain-containing protein 34-like isof... 59 6e-07 ref|XP_022997317.1| U-box domain-containing protein 34-like isof... 59 6e-07 ref|XP_023545444.1| U-box domain-containing protein 35-like [Cuc... 59 6e-07 ref|XP_022929605.1| U-box domain-containing protein 35-like [Cuc... 59 6e-07 ref|XP_011650128.1| PREDICTED: U-box domain-containing protein 5... 59 6e-07 ref|XP_004513115.1| PREDICTED: U-box domain-containing protein 5... 52 1e-06 ref|XP_004513116.1| PREDICTED: U-box domain-containing protein 5... 52 1e-06 ref|XP_017248590.1| PREDICTED: U-box domain-containing protein 5... 58 2e-06 ref|XP_009354312.1| PREDICTED: U-box domain-containing protein 3... 53 2e-06 ref|XP_008368671.1| PREDICTED: U-box domain-containing protein 3... 53 2e-06 >ref|XP_006382208.1| hypothetical protein POPTR_0006s29380g, partial [Populus trichocarpa] Length = 784 Score = 57.4 bits (137), Expect(2) = 1e-09 Identities = 30/46 (65%), Positives = 35/46 (76%) Frame = +3 Query: 384 LNLDDPSPITCLCFFFHLQDDVEAEMRRLKLELKQTMDMYSAACRE 521 L+ D+ +TC QDDVEAEMRRLKLELKQTM+MYS+ACRE Sbjct: 336 LDQDEMQKLTCGAV--KSQDDVEAEMRRLKLELKQTMEMYSSACRE 379 Score = 33.1 bits (74), Expect(2) = 1e-09 Identities = 25/64 (39%), Positives = 34/64 (53%) Frame = +1 Query: 106 GRRGRGNGRQEPDGADISFVSSGMSSGRMSIDHMYLPRLSNGSDSLESTRTPHRLSDAYS 285 G G+ G DISFVS SGR SID ++ P D+ E++RTP RLS+ Sbjct: 268 GLTGKSYGELSVPDTDISFVS----SGRPSIDRIF-PAF---YDNTETSRTPPRLSNFSD 319 Query: 286 IGND 297 I ++ Sbjct: 320 IDSN 323 >ref|XP_018680191.1| PREDICTED: U-box domain-containing protein 52-like [Musa acuminata subsp. malaccensis] ref|XP_018680192.1| PREDICTED: U-box domain-containing protein 52-like [Musa acuminata subsp. malaccensis] ref|XP_018680193.1| PREDICTED: U-box domain-containing protein 52-like [Musa acuminata subsp. malaccensis] Length = 751 Score = 50.4 bits (119), Expect(2) = 5e-09 Identities = 28/57 (49%), Positives = 36/57 (63%) Frame = +3 Query: 351 GKCSASNECTGLNLDDPSPITCLCFFFHLQDDVEAEMRRLKLELKQTMDMYSAACRE 521 G S+SN + L+ + S D+VEAE+RRL+LELKQTMDMYS AC+E Sbjct: 271 GGYSSSNGVSSLSYESSSSPA--------MDEVEAEIRRLRLELKQTMDMYSTACKE 319 Score = 37.7 bits (86), Expect(2) = 5e-09 Identities = 27/67 (40%), Positives = 35/67 (52%), Gaps = 1/67 (1%) Frame = +1 Query: 97 FCSGRRGRGNGRQEPDGADISFVSSGMSSGRMSIDHMYLPRLSNGSDSLE-STRTPHRLS 273 F G R + + +DISFVS+G R S D Y PRLSN SD+L+ S +P + Sbjct: 215 FTRGTRATKSYGEMMMDSDISFVSNG----RPSFDRGYPPRLSNMSDALDRSFESPRKSV 270 Query: 274 DAYSIGN 294 YS N Sbjct: 271 GGYSSSN 277 >ref|XP_009398618.1| PREDICTED: U-box domain-containing protein 52-like isoform X1 [Musa acuminata subsp. malaccensis] Length = 734 Score = 50.8 bits (120), Expect(2) = 6e-09 Identities = 25/40 (62%), Positives = 30/40 (75%) Frame = +3 Query: 402 SPITCLCFFFHLQDDVEAEMRRLKLELKQTMDMYSAACRE 521 SP + F + ++V+AEM RLKLELKQTMDMYS ACRE Sbjct: 278 SPRSNGSFSSQMSEEVKAEMNRLKLELKQTMDMYSTACRE 317 Score = 37.0 bits (84), Expect(2) = 6e-09 Identities = 23/41 (56%), Positives = 28/41 (68%), Gaps = 5/41 (12%) Frame = +1 Query: 178 SSGRMSIDHMYLPRLSNGSD----SLESTRTPHRLS-DAYS 285 SSG+ SIDH++ RLS SD S ES ++PHR S DAYS Sbjct: 232 SSGKPSIDHLFPQRLSCISDGLDCSFESVQSPHRSSLDAYS 272 >ref|XP_009398619.1| PREDICTED: U-box domain-containing protein 52-like isoform X2 [Musa acuminata subsp. malaccensis] Length = 725 Score = 50.8 bits (120), Expect(2) = 6e-09 Identities = 25/40 (62%), Positives = 30/40 (75%) Frame = +3 Query: 402 SPITCLCFFFHLQDDVEAEMRRLKLELKQTMDMYSAACRE 521 SP + F + ++V+AEM RLKLELKQTMDMYS ACRE Sbjct: 278 SPRSNGSFSSQMSEEVKAEMNRLKLELKQTMDMYSTACRE 317 Score = 37.0 bits (84), Expect(2) = 6e-09 Identities = 23/41 (56%), Positives = 28/41 (68%), Gaps = 5/41 (12%) Frame = +1 Query: 178 SSGRMSIDHMYLPRLSNGSD----SLESTRTPHRLS-DAYS 285 SSG+ SIDH++ RLS SD S ES ++PHR S DAYS Sbjct: 232 SSGKPSIDHLFPQRLSCISDGLDCSFESVQSPHRSSLDAYS 272 >ref|XP_018679849.1| PREDICTED: U-box domain-containing protein 52-like isoform X3 [Musa acuminata subsp. malaccensis] Length = 655 Score = 50.8 bits (120), Expect(2) = 6e-09 Identities = 25/40 (62%), Positives = 30/40 (75%) Frame = +3 Query: 402 SPITCLCFFFHLQDDVEAEMRRLKLELKQTMDMYSAACRE 521 SP + F + ++V+AEM RLKLELKQTMDMYS ACRE Sbjct: 199 SPRSNGSFSSQMSEEVKAEMNRLKLELKQTMDMYSTACRE 238 Score = 37.0 bits (84), Expect(2) = 6e-09 Identities = 23/41 (56%), Positives = 28/41 (68%), Gaps = 5/41 (12%) Frame = +1 Query: 178 SSGRMSIDHMYLPRLSNGSD----SLESTRTPHRLS-DAYS 285 SSG+ SIDH++ RLS SD S ES ++PHR S DAYS Sbjct: 153 SSGKPSIDHLFPQRLSCISDGLDCSFESVQSPHRSSLDAYS 193 >ref|XP_007160217.1| hypothetical protein PHAVU_002G302700g [Phaseolus vulgaris] gb|ESW32211.1| hypothetical protein PHAVU_002G302700g [Phaseolus vulgaris] Length = 778 Score = 57.4 bits (137), Expect(2) = 2e-08 Identities = 30/58 (51%), Positives = 39/58 (67%) Frame = +3 Query: 348 YGKCSASNECTGLNLDDPSPITCLCFFFHLQDDVEAEMRRLKLELKQTMDMYSAACRE 521 +G S S++ +G+++ F QDDVEAEMRRLKLELKQTM+MYS AC+E Sbjct: 304 HGDFSFSSQDSGMSMSSS--------MFSAQDDVEAEMRRLKLELKQTMEMYSTACKE 353 Score = 28.5 bits (62), Expect(2) = 2e-08 Identities = 23/58 (39%), Positives = 28/58 (48%), Gaps = 15/58 (25%) Frame = +1 Query: 109 RRGRGNGRQEPDGA----DISFVSSGMSSGRMSIDHMY-----------LPRLSNGSD 237 R GRG + + + DISFVSSG R S+D M+ PRLS GSD Sbjct: 233 RPGRGGSYRSYESSVADSDISFVSSG----RPSVDRMFPSMYDDMDSSMNPRLSTGSD 286 >gb|ONK70170.1| uncharacterized protein A4U43_C05F30990 [Asparagus officinalis] Length = 771 Score = 62.0 bits (149), Expect = 6e-08 Identities = 48/91 (52%), Positives = 51/91 (56%), Gaps = 24/91 (26%) Frame = +1 Query: 97 FCSGRRGRGNGRQEPD-------GADISFVSS-GMSSGRMSIDH----------MYLPRL 222 F G RG N + + GADISFVSS GMSSGR SID MY PRL Sbjct: 224 FSRGARGCSNIKSFAELSLSSDGGADISFVSSSGMSSGRPSIDRPSIDRPSIDRMYPPRL 283 Query: 223 SNGSDSL-----ESTRTPHRLS-DAYSIGND 297 SN SDSL S+ TPHR S DAYSIGND Sbjct: 284 SNVSDSLNHSFESSSHTPHRSSADAYSIGND 314 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 432 HLQDDVEAEMRRLKLELKQTMDMYSAACRE 521 H DDVEAEM+RLKLELKQTMDMYSAAC+E Sbjct: 331 HAMDDVEAEMKRLKLELKQTMDMYSAACKE 360 >gb|OWM69481.1| hypothetical protein CDL15_Pgr013942 [Punica granatum] Length = 772 Score = 52.8 bits (125), Expect(2) = 4e-07 Identities = 25/45 (55%), Positives = 32/45 (71%) Frame = +3 Query: 387 NLDDPSPITCLCFFFHLQDDVEAEMRRLKLELKQTMDMYSAACRE 521 ++ + S T F H D+VE E+RRL+LELKQTMDMYS AC+E Sbjct: 316 SVSEESGRTSCSFSSHYMDEVEHEIRRLRLELKQTMDMYSTACKE 360 Score = 28.9 bits (63), Expect(2) = 4e-07 Identities = 25/65 (38%), Positives = 32/65 (49%), Gaps = 15/65 (23%) Frame = +1 Query: 127 GRQEPDG------ADISFVSSGMSSGRMSIDHMYL---------PRLSNGSDSLESTRTP 261 GR P G DISF MSSGR S DH +L R+S +DSL S R+ Sbjct: 248 GRASPHGDMSESETDISF----MSSGRPSSDHTFLCDDIDAALSSRISTSTDSL-SMRSG 302 Query: 262 HRLSD 276 ++ +D Sbjct: 303 YKWND 307 >gb|PKI38204.1| hypothetical protein CRG98_041457, partial [Punica granatum] Length = 340 Score = 52.8 bits (125), Expect(2) = 4e-07 Identities = 25/45 (55%), Positives = 32/45 (71%) Frame = +3 Query: 387 NLDDPSPITCLCFFFHLQDDVEAEMRRLKLELKQTMDMYSAACRE 521 ++ + S T F H D+VE E+RRL+LELKQTMDMYS AC+E Sbjct: 255 SVSEESGRTSCSFSSHYMDEVEHEIRRLRLELKQTMDMYSTACKE 299 Score = 28.9 bits (63), Expect(2) = 4e-07 Identities = 25/65 (38%), Positives = 32/65 (49%), Gaps = 15/65 (23%) Frame = +1 Query: 127 GRQEPDG------ADISFVSSGMSSGRMSIDHMYL---------PRLSNGSDSLESTRTP 261 GR P G DISF MSSGR S DH +L R+S +DSL S R+ Sbjct: 187 GRASPHGDMSESETDISF----MSSGRPSSDHTFLCDDIDAALSSRISTSTDSL-SMRSG 241 Query: 262 HRLSD 276 ++ +D Sbjct: 242 YKWND 246 >gb|KGN61212.1| hypothetical protein Csa_2G070290 [Cucumis sativus] Length = 578 Score = 58.9 bits (141), Expect = 6e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 432 HLQDDVEAEMRRLKLELKQTMDMYSAACRE 521 H QDDVEAEMRRLKLELKQTMDMYS AC+E Sbjct: 108 HAQDDVEAEMRRLKLELKQTMDMYSTACKE 137 >ref|XP_022997318.1| U-box domain-containing protein 34-like isoform X2 [Cucurbita maxima] Length = 641 Score = 58.9 bits (141), Expect = 6e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 432 HLQDDVEAEMRRLKLELKQTMDMYSAACRE 521 H QDDVEAEMRRLKLELKQTMDMYS AC+E Sbjct: 181 HAQDDVEAEMRRLKLELKQTMDMYSTACKE 210 >ref|XP_022997317.1| U-box domain-containing protein 34-like isoform X1 [Cucurbita maxima] Length = 667 Score = 58.9 bits (141), Expect = 6e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 432 HLQDDVEAEMRRLKLELKQTMDMYSAACRE 521 H QDDVEAEMRRLKLELKQTMDMYS AC+E Sbjct: 181 HAQDDVEAEMRRLKLELKQTMDMYSTACKE 210 >ref|XP_023545444.1| U-box domain-containing protein 35-like [Cucurbita pepo subsp. pepo] Length = 816 Score = 58.9 bits (141), Expect = 6e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 432 HLQDDVEAEMRRLKLELKQTMDMYSAACRE 521 H QDDVEAEMRRLKLELKQTMDMYS AC+E Sbjct: 356 HAQDDVEAEMRRLKLELKQTMDMYSTACKE 385 >ref|XP_022929605.1| U-box domain-containing protein 35-like [Cucurbita moschata] Length = 816 Score = 58.9 bits (141), Expect = 6e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 432 HLQDDVEAEMRRLKLELKQTMDMYSAACRE 521 H QDDVEAEMRRLKLELKQTMDMYS AC+E Sbjct: 356 HAQDDVEAEMRRLKLELKQTMDMYSTACKE 385 >ref|XP_011650128.1| PREDICTED: U-box domain-containing protein 52-like [Cucumis sativus] Length = 850 Score = 58.9 bits (141), Expect = 6e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 432 HLQDDVEAEMRRLKLELKQTMDMYSAACRE 521 H QDDVEAEMRRLKLELKQTMDMYS AC+E Sbjct: 380 HAQDDVEAEMRRLKLELKQTMDMYSTACKE 409 >ref|XP_004513115.1| PREDICTED: U-box domain-containing protein 52-like isoform X1 [Cicer arietinum] Length = 822 Score = 52.0 bits (123), Expect(2) = 1e-06 Identities = 28/53 (52%), Positives = 35/53 (66%) Frame = +3 Query: 363 ASNECTGLNLDDPSPITCLCFFFHLQDDVEAEMRRLKLELKQTMDMYSAACRE 521 ++N + L L D S D+VEAEMRRLKLELKQTM+MYS+AC+E Sbjct: 341 SANASSSLRLSDAS------------DEVEAEMRRLKLELKQTMEMYSSACKE 381 Score = 27.7 bits (60), Expect(2) = 1e-06 Identities = 24/56 (42%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Frame = +1 Query: 109 RRGRGNGRQEPDGADISFVSSGMSSGRMSIDHMYLPRLSNGSD-SLESTRTPHRLS 273 RRG +DISFVS SGR SID ++ P L N D S+ P RLS Sbjct: 251 RRGHKAYESSIPDSDISFVS----SGRPSIDRIF-PSLYNVDDLDNSSSGIPSRLS 301 >ref|XP_004513116.1| PREDICTED: U-box domain-containing protein 52-like isoform X2 [Cicer arietinum] Length = 821 Score = 52.0 bits (123), Expect(2) = 1e-06 Identities = 28/53 (52%), Positives = 35/53 (66%) Frame = +3 Query: 363 ASNECTGLNLDDPSPITCLCFFFHLQDDVEAEMRRLKLELKQTMDMYSAACRE 521 ++N + L L D S D+VEAEMRRLKLELKQTM+MYS+AC+E Sbjct: 340 SANASSSLRLSDAS------------DEVEAEMRRLKLELKQTMEMYSSACKE 380 Score = 27.7 bits (60), Expect(2) = 1e-06 Identities = 24/56 (42%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Frame = +1 Query: 109 RRGRGNGRQEPDGADISFVSSGMSSGRMSIDHMYLPRLSNGSD-SLESTRTPHRLS 273 RRG +DISFVS SGR SID ++ P L N D S+ P RLS Sbjct: 250 RRGHKAYESSIPDSDISFVS----SGRPSIDRIF-PSLYNVDDLDNSSSGIPSRLS 300 >ref|XP_017248590.1| PREDICTED: U-box domain-containing protein 52 [Daucus carota subsp. sativus] gb|KZM98051.1| hypothetical protein DCAR_014587 [Daucus carota subsp. sativus] Length = 745 Score = 57.8 bits (138), Expect = 2e-06 Identities = 36/61 (59%), Positives = 40/61 (65%), Gaps = 3/61 (4%) Frame = +3 Query: 348 YGKCSASNE---CTGLNLDDPSPITCLCFFFHLQDDVEAEMRRLKLELKQTMDMYSAACR 518 +G SNE T L+LD SP H DDVEAEMRRLKLELKQTMDMYS+AC+ Sbjct: 273 FGSAFNSNEGLNSTSLSLDS-SPS-------HKVDDVEAEMRRLKLELKQTMDMYSSACK 324 Query: 519 E 521 E Sbjct: 325 E 325 >ref|XP_009354312.1| PREDICTED: U-box domain-containing protein 35-like [Pyrus x bretschneideri] Length = 752 Score = 52.8 bits (125), Expect(2) = 2e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +3 Query: 441 DDVEAEMRRLKLELKQTMDMYSAACRE 521 DDVEAEMRRLKLELKQTM+MYS AC+E Sbjct: 295 DDVEAEMRRLKLELKQTMEMYSTACKE 321 Score = 26.6 bits (57), Expect(2) = 2e-06 Identities = 29/93 (31%), Positives = 36/93 (38%) Frame = +1 Query: 97 FCSGRRGRGNGRQEPDGADISFVSSGMSSGRMSIDHMYLPRLSNGSDSLESTRTPHRLSD 276 F GR + DISFVS SGR SID M PR G +S ++R Sbjct: 199 FARGRPSMDKSYELSPETDISFVS----SGRPSIDRM-SPRCDFGVESGMNSR------- 246 Query: 277 AYSIGNDXXXXXXXXXXXXXXXXNMASAVHPMS 375 SIG+D +M S + MS Sbjct: 247 -LSIGSDGDNRSSTSSYSRHKFLDMGSLQYEMS 278 >ref|XP_008368671.1| PREDICTED: U-box domain-containing protein 35-like [Malus domestica] Length = 752 Score = 52.8 bits (125), Expect(2) = 2e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +3 Query: 441 DDVEAEMRRLKLELKQTMDMYSAACRE 521 DDVEAEMRRLKLELKQTM+MYS AC+E Sbjct: 295 DDVEAEMRRLKLELKQTMEMYSTACKE 321 Score = 26.6 bits (57), Expect(2) = 2e-06 Identities = 29/93 (31%), Positives = 36/93 (38%) Frame = +1 Query: 97 FCSGRRGRGNGRQEPDGADISFVSSGMSSGRMSIDHMYLPRLSNGSDSLESTRTPHRLSD 276 F GR + DISFVS SGR SID M PR G +S ++R Sbjct: 199 FARGRPSMDKSYELSPETDISFVS----SGRPSIDRM-SPRCDFGVESGMNSR------- 246 Query: 277 AYSIGNDXXXXXXXXXXXXXXXXNMASAVHPMS 375 SIG+D +M S + MS Sbjct: 247 -LSIGSDGDNRSSTSSYSRHKFLDMGSLQYEMS 278