BLASTX nr result
ID: Ophiopogon26_contig00028272
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00028272 (739 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020272834.1| putative F-box/LRR-repeat protein At3g18150 ... 59 2e-06 gb|ONK65664.1| uncharacterized protein A4U43_C07F39410 [Asparagu... 59 2e-06 >ref|XP_020272834.1| putative F-box/LRR-repeat protein At3g18150 [Asparagus officinalis] Length = 296 Score = 58.9 bits (141), Expect = 2e-06 Identities = 27/39 (69%), Positives = 36/39 (92%) Frame = -3 Query: 119 RQCPKLRSIKISGSELRLRSLIVVDCFRVNEIEIFASNL 3 RQC +LRSIK+SGS LRL+SL+VV+C++++EIEIFA NL Sbjct: 194 RQCFELRSIKVSGSNLRLKSLVVVNCWKLDEIEIFAPNL 232 >gb|ONK65664.1| uncharacterized protein A4U43_C07F39410 [Asparagus officinalis] Length = 464 Score = 58.9 bits (141), Expect = 2e-06 Identities = 27/39 (69%), Positives = 36/39 (92%) Frame = -3 Query: 119 RQCPKLRSIKISGSELRLRSLIVVDCFRVNEIEIFASNL 3 RQC +LRSIK+SGS LRL+SL+VV+C++++EIEIFA NL Sbjct: 194 RQCFELRSIKVSGSNLRLKSLVVVNCWKLDEIEIFAPNL 232