BLASTX nr result
ID: Ophiopogon26_contig00027944
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00027944 (414 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020265074.1| membrane-bound transcription factor site-2 p... 66 6e-10 ref|XP_020265073.1| membrane-bound transcription factor site-2 p... 66 6e-10 >ref|XP_020265074.1| membrane-bound transcription factor site-2 protease homolog isoform X2 [Asparagus officinalis] Length = 472 Score = 66.2 bits (160), Expect = 6e-10 Identities = 31/42 (73%), Positives = 34/42 (80%) Frame = -2 Query: 128 GGKQNLLPLRTGQVSSSRSCWYFDLKIRALNDALFSIGYRYA 3 G +QNLLPLRTGQVS S SCWY D KIRA N+ LF IG+RYA Sbjct: 10 GRQQNLLPLRTGQVSKSLSCWYCDWKIRAFNEKLFFIGHRYA 51 >ref|XP_020265073.1| membrane-bound transcription factor site-2 protease homolog isoform X1 [Asparagus officinalis] Length = 524 Score = 66.2 bits (160), Expect = 6e-10 Identities = 31/42 (73%), Positives = 34/42 (80%) Frame = -2 Query: 128 GGKQNLLPLRTGQVSSSRSCWYFDLKIRALNDALFSIGYRYA 3 G +QNLLPLRTGQVS S SCWY D KIRA N+ LF IG+RYA Sbjct: 10 GRQQNLLPLRTGQVSKSLSCWYCDWKIRAFNEKLFFIGHRYA 51