BLASTX nr result
ID: Ophiopogon26_contig00027921
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00027921 (793 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010059808.1| PREDICTED: F-box protein At3g12350 [Eucalypt... 60 2e-06 ref|XP_020242312.1| F-box protein At3g12350 [Asparagus officinal... 57 1e-05 >ref|XP_010059808.1| PREDICTED: F-box protein At3g12350 [Eucalyptus grandis] gb|KCW66255.1| hypothetical protein EUGRSUZ_F00088 [Eucalyptus grandis] Length = 454 Score = 59.7 bits (143), Expect = 2e-06 Identities = 25/40 (62%), Positives = 29/40 (72%) Frame = +3 Query: 3 RRWDPEHFVSIESCCPSPARPLQGLWKVIGTSTPMEICYV 122 RRW+PEHFV I C P+P+RPLQGLWK IG T +E V Sbjct: 279 RRWEPEHFVKIVDCSPTPSRPLQGLWKGIGDCTKLEFYLV 318 >ref|XP_020242312.1| F-box protein At3g12350 [Asparagus officinalis] gb|ONK59805.1| uncharacterized protein A4U43_C08F10890 [Asparagus officinalis] Length = 262 Score = 56.6 bits (135), Expect = 1e-05 Identities = 25/40 (62%), Positives = 29/40 (72%) Frame = +3 Query: 3 RRWDPEHFVSIESCCPSPARPLQGLWKVIGTSTPMEICYV 122 +RWD EHFV IE+CCPS ARPLQGLWK I S ++ V Sbjct: 84 KRWDAEHFVKIENCCPSLARPLQGLWKGICESMYLDFYLV 123