BLASTX nr result
ID: Ophiopogon26_contig00027874
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00027874 (534 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020269565.1| uncharacterized protein LOC109844826 [Aspara... 54 6e-06 >ref|XP_020269565.1| uncharacterized protein LOC109844826 [Asparagus officinalis] gb|ONK66050.1| uncharacterized protein A4U43_C06F3650 [Asparagus officinalis] Length = 148 Score = 53.9 bits (128), Expect = 6e-06 Identities = 32/52 (61%), Positives = 36/52 (69%), Gaps = 4/52 (7%) Frame = +2 Query: 389 VSGLRMPQKIQLKATTKRSSTSCFRTK----CSVALPETLGIVQSTIAKQLS 532 V+GLR+P+ IQLK TK S R K CSVA PETL IVQ+TIAKQLS Sbjct: 34 VNGLRLPRSIQLKGVTKSSLPFSRRFKSKISCSVAQPETLEIVQNTIAKQLS 85