BLASTX nr result
ID: Ophiopogon26_contig00027705
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00027705 (425 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020241658.1| cyclin-dependent kinase F-4-like isoform X1 ... 64 6e-09 gb|ONK58912.1| uncharacterized protein A4U43_C08F1000 [Asparagus... 64 6e-09 >ref|XP_020241658.1| cyclin-dependent kinase F-4-like isoform X1 [Asparagus officinalis] ref|XP_020241659.1| cyclin-dependent kinase F-4-like isoform X2 [Asparagus officinalis] Length = 469 Score = 63.5 bits (153), Expect = 6e-09 Identities = 31/48 (64%), Positives = 38/48 (79%), Gaps = 1/48 (2%) Frame = -3 Query: 423 TWDIPDDKLTNSTKGKYGEVFDVADKFTQMKVSYVPQSLSR-PPLAGG 283 TWDIPD+KL +S Y +V ++AD FTQ+KVS VPQ+LSR PPLAGG Sbjct: 401 TWDIPDEKLAHSRGPYYNKVSNIADNFTQLKVSSVPQNLSRPPPLAGG 448 >gb|ONK58912.1| uncharacterized protein A4U43_C08F1000 [Asparagus officinalis] Length = 509 Score = 63.5 bits (153), Expect = 6e-09 Identities = 31/48 (64%), Positives = 38/48 (79%), Gaps = 1/48 (2%) Frame = -3 Query: 423 TWDIPDDKLTNSTKGKYGEVFDVADKFTQMKVSYVPQSLSR-PPLAGG 283 TWDIPD+KL +S Y +V ++AD FTQ+KVS VPQ+LSR PPLAGG Sbjct: 441 TWDIPDEKLAHSRGPYYNKVSNIADNFTQLKVSSVPQNLSRPPPLAGG 488