BLASTX nr result
ID: Ophiopogon26_contig00027642
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00027642 (374 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020265358.1| glycerophosphodiester phosphodiesterase GDPD... 59 2e-07 >ref|XP_020265358.1| glycerophosphodiester phosphodiesterase GDPDL3-like [Asparagus officinalis] gb|ONK70122.1| uncharacterized protein A4U43_C05F30490 [Asparagus officinalis] Length = 756 Score = 58.9 bits (141), Expect = 2e-07 Identities = 29/47 (61%), Positives = 35/47 (74%), Gaps = 1/47 (2%) Frame = +3 Query: 69 EPPLPPA-VKPTISVPPTSQPSAGPPQHLAAVFSLPWAIAMLTGALL 206 EPPLPPA +KP +S+PP SQPS G P+HL A F L AIA ++G LL Sbjct: 709 EPPLPPASLKPAVSIPPASQPSEGSPRHLFASFLLSLAIATVSGLLL 755