BLASTX nr result
ID: Ophiopogon26_contig00027641
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00027641 (402 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020242262.1| uncharacterized protein LOC109820518 [Aspara... 60 5e-08 >ref|XP_020242262.1| uncharacterized protein LOC109820518 [Asparagus officinalis] ref|XP_020242263.1| uncharacterized protein LOC109820518 [Asparagus officinalis] ref|XP_020242264.1| uncharacterized protein LOC109820518 [Asparagus officinalis] gb|ONK60511.1| uncharacterized protein A4U43_C08F19260 [Asparagus officinalis] Length = 277 Score = 59.7 bits (143), Expect(2) = 5e-08 Identities = 27/39 (69%), Positives = 30/39 (76%) Frame = +1 Query: 223 REFINGRVNAYALCCADESLMKEFIDMNNSGNEIEGMET 339 +EFIN VNAYAL C DE L KE +DM NSG E+EGMET Sbjct: 122 KEFINAGVNAYALGCTDEGLRKELLDMKNSGTEVEGMET 160 Score = 25.0 bits (53), Expect(2) = 5e-08 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +3 Query: 327 GDGNFSGGTSLRFKFLSEK 383 G + GGTSLRF+ LS++ Sbjct: 157 GMETYGGGTSLRFRILSDE 175