BLASTX nr result
ID: Ophiopogon26_contig00027628
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00027628 (489 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010905690.1| PREDICTED: uncharacterized protein LOC105032... 48 3e-07 ref|XP_020273270.1| chromodomain-helicase-DNA-binding protein 5-... 44 6e-07 >ref|XP_010905690.1| PREDICTED: uncharacterized protein LOC105032814 [Elaeis guineensis] Length = 793 Score = 47.8 bits (112), Expect(2) = 3e-07 Identities = 33/64 (51%), Positives = 39/64 (60%), Gaps = 7/64 (10%) Frame = +1 Query: 319 TTRGRSSTMVDSDSELFNFDDVISEEELVRDLRIGWGL-------ILTLRKGEGKGTEKQ 477 T R RS + V S+SE + D VISEEEL RDL +G L I RKGE KG EK+ Sbjct: 305 TRRKRSPSSVGSESESSDCDYVISEEEL-RDLGVGGVLSQPQSERIFARRKGEEKGKEKE 363 Query: 478 ADDS 489 AD+S Sbjct: 364 ADES 367 Score = 34.3 bits (77), Expect(2) = 3e-07 Identities = 14/28 (50%), Positives = 20/28 (71%) Frame = +2 Query: 230 DEFVVKEDVLVDKQRNKSKKARKRRIEP 313 D+FV K+ + +D +RNKSKK RK+ P Sbjct: 276 DDFVEKDRIALDNRRNKSKKGRKKTAAP 303 >ref|XP_020273270.1| chromodomain-helicase-DNA-binding protein 5-like [Asparagus officinalis] gb|ONK63284.1| uncharacterized protein A4U43_C07F13380 [Asparagus officinalis] Length = 846 Score = 43.5 bits (101), Expect(2) = 6e-07 Identities = 29/65 (44%), Positives = 39/65 (60%), Gaps = 8/65 (12%) Frame = +1 Query: 319 TTRGRSSTMVDSDSELFNFDDVISEEELVRDLRIGWGLIL--------TLRKGEGKGTEK 474 T R RS+++VDSDSE + D++ EEE V DLR G GL++ +K E KG E+ Sbjct: 375 TKRKRSNSLVDSDSESLDVDEMTLEEE-VMDLRRG-GLLMIEQPKRVTATKKAEEKGKER 432 Query: 475 QADDS 489 Q D S Sbjct: 433 QVDSS 437 Score = 37.4 bits (85), Expect(2) = 6e-07 Identities = 14/28 (50%), Positives = 23/28 (82%) Frame = +2 Query: 230 DEFVVKEDVLVDKQRNKSKKARKRRIEP 313 DEF+++++ L+DK+RN+SKK R +R P Sbjct: 346 DEFLIEDEFLIDKERNQSKKTRGKRTGP 373