BLASTX nr result
ID: Ophiopogon26_contig00027573
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00027573 (596 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO82138.1| hypothetical protein CISIN_1g012606mg [Citrus sin... 58 2e-06 gb|ESR51428.1| hypothetical protein CICLE_v10031545mg [Citrus cl... 58 2e-06 >gb|KDO82138.1| hypothetical protein CISIN_1g012606mg [Citrus sinensis] Length = 325 Score = 57.8 bits (138), Expect = 2e-06 Identities = 20/32 (62%), Positives = 24/32 (75%) Frame = +1 Query: 103 SCIWKRAGYQFCCGCEYWDNNYWFSSWSSLFR 198 S WK+ GY+ CCGC YWDN+ WF SWS +FR Sbjct: 280 SFTWKKKGYKICCGCWYWDNSCWFRSWSHMFR 311 >gb|ESR51428.1| hypothetical protein CICLE_v10031545mg [Citrus clementina] gb|ESR51429.1| hypothetical protein CICLE_v10031545mg [Citrus clementina] gb|ESR51432.1| hypothetical protein CICLE_v10031545mg [Citrus clementina] gb|ESR51435.1| hypothetical protein CICLE_v10031545mg [Citrus clementina] Length = 325 Score = 57.8 bits (138), Expect = 2e-06 Identities = 20/32 (62%), Positives = 24/32 (75%) Frame = +1 Query: 103 SCIWKRAGYQFCCGCEYWDNNYWFSSWSSLFR 198 S WK+ GY+ CCGC YWDN+ WF SWS +FR Sbjct: 280 SFTWKKKGYKICCGCWYWDNSCWFRSWSHMFR 311