BLASTX nr result
ID: Ophiopogon26_contig00027282
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00027282 (357 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020085179.1| bifunctional nitrilase/nitrile hydratase NIT... 80 2e-15 ref|XP_017697763.1| PREDICTED: bifunctional nitrilase/nitrile hy... 78 4e-15 ref|XP_011088937.1| bifunctional nitrilase/nitrile hydratase NIT... 77 6e-14 ref|XP_020247275.1| bifunctional nitrilase/nitrile hydratase NIT... 75 1e-13 ref|XP_020247274.1| bifunctional nitrilase/nitrile hydratase NIT... 75 2e-13 ref|XP_010918400.1| PREDICTED: bifunctional nitrilase/nitrile hy... 75 2e-13 gb|PIN20715.1| Cyanoalanine nitrilase [Handroanthus impetiginosus] 73 3e-13 ref|XP_010265779.1| PREDICTED: bifunctional nitrilase/nitrile hy... 73 3e-13 ref|XP_020693643.1| bifunctional nitrilase/nitrile hydratase NIT... 73 9e-13 ref|XP_010265778.1| PREDICTED: bifunctional nitrilase/nitrile hy... 73 9e-13 ref|XP_019163963.1| PREDICTED: bifunctional nitrilase/nitrile hy... 73 1e-12 ref|XP_011627159.1| bifunctional nitrilase/nitrile hydratase NIT... 72 1e-12 ref|XP_006854746.1| bifunctional nitrilase/nitrile hydratase NIT... 72 2e-12 ref|XP_012850391.1| PREDICTED: bifunctional nitrilase/nitrile hy... 72 2e-12 gb|PKA52151.1| Bifunctional nitrilase/nitrile hydratase NIT4 [Ap... 72 2e-12 ref|XP_014518652.1| bifunctional nitrilase/nitrile hydratase NIT... 72 2e-12 gb|KCW84883.1| hypothetical protein EUGRSUZ_B01705 [Eucalyptus g... 69 3e-12 gb|KCW44412.1| hypothetical protein EUGRSUZ_L02100 [Eucalyptus g... 69 3e-12 ref|XP_022862911.1| bifunctional nitrilase/nitrile hydratase NIT... 71 5e-12 ref|XP_015953946.1| bifunctional nitrilase/nitrile hydratase NIT... 71 6e-12 >ref|XP_020085179.1| bifunctional nitrilase/nitrile hydratase NIT4B-like [Ananas comosus] gb|OAY74666.1| Bifunctional nitrilase/nitrile hydratase NIT4B [Ananas comosus] Length = 354 Score = 80.5 bits (197), Expect = 2e-15 Identities = 37/43 (86%), Positives = 41/43 (95%) Frame = -3 Query: 355 RAKFDFDVVGHYSRPEVLSLTVKDHPLNPVSFTSAVRAESSQK 227 RAKFDFDVVGHY+RPEVLSLTV+DHPLNPVSF SA ++ESSQK Sbjct: 311 RAKFDFDVVGHYARPEVLSLTVEDHPLNPVSFASAAKSESSQK 353 >ref|XP_017697763.1| PREDICTED: bifunctional nitrilase/nitrile hydratase NIT4-like [Phoenix dactylifera] Length = 233 Score = 78.2 bits (191), Expect = 4e-15 Identities = 36/43 (83%), Positives = 39/43 (90%) Frame = -3 Query: 355 RAKFDFDVVGHYSRPEVLSLTVKDHPLNPVSFTSAVRAESSQK 227 RAKFDFDVVGHYSRPEVL+LTVKDHP NPVSF SA + E+SQK Sbjct: 190 RAKFDFDVVGHYSRPEVLTLTVKDHPQNPVSFASAAKTENSQK 232 >ref|XP_011088937.1| bifunctional nitrilase/nitrile hydratase NIT4A [Sesamum indicum] Length = 377 Score = 76.6 bits (187), Expect = 6e-14 Identities = 38/44 (86%), Positives = 41/44 (93%), Gaps = 1/44 (2%) Frame = -3 Query: 355 RAKFDFDVVGHYSRPEVLSLTVKDHPLNPVSFTSAV-RAESSQK 227 RAKFDFDVVGHYSRPEVLSLTVKDHP+ PVSFTSA +AE+SQK Sbjct: 334 RAKFDFDVVGHYSRPEVLSLTVKDHPMTPVSFTSASGKAETSQK 377 >ref|XP_020247275.1| bifunctional nitrilase/nitrile hydratase NIT4-like isoform X2 [Asparagus officinalis] Length = 289 Score = 75.1 bits (183), Expect = 1e-13 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = -3 Query: 355 RAKFDFDVVGHYSRPEVLSLTVKDHPLNPVSFTSAVRAES 236 RAKFDFDV+GHYSRPEVLSLTVKDHP N VSFTSA +AES Sbjct: 249 RAKFDFDVIGHYSRPEVLSLTVKDHPQNAVSFTSAAKAES 288 >ref|XP_020247274.1| bifunctional nitrilase/nitrile hydratase NIT4B-like isoform X1 [Asparagus officinalis] gb|ONK56637.1| uncharacterized protein A4U43_C10F11060 [Asparagus officinalis] Length = 349 Score = 75.1 bits (183), Expect = 2e-13 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = -3 Query: 355 RAKFDFDVVGHYSRPEVLSLTVKDHPLNPVSFTSAVRAES 236 RAKFDFDV+GHYSRPEVLSLTVKDHP N VSFTSA +AES Sbjct: 309 RAKFDFDVIGHYSRPEVLSLTVKDHPQNAVSFTSAAKAES 348 >ref|XP_010918400.1| PREDICTED: bifunctional nitrilase/nitrile hydratase NIT4B [Elaeis guineensis] Length = 355 Score = 75.1 bits (183), Expect = 2e-13 Identities = 35/43 (81%), Positives = 38/43 (88%) Frame = -3 Query: 355 RAKFDFDVVGHYSRPEVLSLTVKDHPLNPVSFTSAVRAESSQK 227 RAKFDFDVVGHYSRPEVLSLTVKDHP +PV F SA + E+SQK Sbjct: 312 RAKFDFDVVGHYSRPEVLSLTVKDHPQDPVLFASAAKTENSQK 354 >gb|PIN20715.1| Cyanoalanine nitrilase [Handroanthus impetiginosus] Length = 233 Score = 73.2 bits (178), Expect = 3e-13 Identities = 35/44 (79%), Positives = 40/44 (90%), Gaps = 1/44 (2%) Frame = -3 Query: 355 RAKFDFDVVGHYSRPEVLSLTVKDHPLNPVSFTSAV-RAESSQK 227 RAKFDFDVVGHYSRPE+LSL VKDHP++PVSFTS+ + ESSQK Sbjct: 190 RAKFDFDVVGHYSRPEILSLVVKDHPMSPVSFTSSSGKVESSQK 233 >ref|XP_010265779.1| PREDICTED: bifunctional nitrilase/nitrile hydratase NIT4A-like isoform X2 [Nelumbo nucifera] Length = 241 Score = 73.2 bits (178), Expect = 3e-13 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = -3 Query: 355 RAKFDFDVVGHYSRPEVLSLTVKDHPLNPVSFTSAVRAESSQK 227 RAKFDFDVVGHY+RPEVLSLTV+DHP PV+FTSA + E SQK Sbjct: 190 RAKFDFDVVGHYARPEVLSLTVRDHPSIPVNFTSAEKTEGSQK 232 >ref|XP_020693643.1| bifunctional nitrilase/nitrile hydratase NIT4-like [Dendrobium catenatum] gb|PKU64026.1| Bifunctional nitrilase/nitrile hydratase NIT4 [Dendrobium catenatum] Length = 351 Score = 73.2 bits (178), Expect = 9e-13 Identities = 35/43 (81%), Positives = 36/43 (83%) Frame = -3 Query: 355 RAKFDFDVVGHYSRPEVLSLTVKDHPLNPVSFTSAVRAESSQK 227 RAKFDFDVVGHYSRPEVLSLTVKDHP +PV FT A ES QK Sbjct: 308 RAKFDFDVVGHYSRPEVLSLTVKDHPQHPVFFTYAANKESEQK 350 >ref|XP_010265778.1| PREDICTED: bifunctional nitrilase/nitrile hydratase NIT4B-like isoform X1 [Nelumbo nucifera] Length = 356 Score = 73.2 bits (178), Expect = 9e-13 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = -3 Query: 355 RAKFDFDVVGHYSRPEVLSLTVKDHPLNPVSFTSAVRAESSQK 227 RAKFDFDVVGHY+RPEVLSLTV+DHP PV+FTSA + E SQK Sbjct: 305 RAKFDFDVVGHYARPEVLSLTVRDHPSIPVNFTSAEKTEGSQK 347 >ref|XP_019163963.1| PREDICTED: bifunctional nitrilase/nitrile hydratase NIT4A [Ipomoea nil] Length = 379 Score = 73.2 bits (178), Expect = 1e-12 Identities = 36/44 (81%), Positives = 40/44 (90%), Gaps = 1/44 (2%) Frame = -3 Query: 355 RAKFDFDVVGHYSRPEVLSLTVKDHPLNPVSFTSAV-RAESSQK 227 RAKFDFDVVGHYSRPEVLSL V+DHPLNPV+FTSA +AE+S K Sbjct: 336 RAKFDFDVVGHYSRPEVLSLVVRDHPLNPVTFTSASNKAETSAK 379 >ref|XP_011627159.1| bifunctional nitrilase/nitrile hydratase NIT4A isoform X2 [Amborella trichopoda] Length = 315 Score = 72.4 bits (176), Expect = 1e-12 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = -3 Query: 355 RAKFDFDVVGHYSRPEVLSLTVKDHPLNPVSFTSAVRAESSQK 227 RAKFDFDVVGHY+RP+VLSLTVKDHPL PVSF S ++AE +K Sbjct: 271 RAKFDFDVVGHYARPDVLSLTVKDHPLVPVSFASNIKAEGPKK 313 >ref|XP_006854746.1| bifunctional nitrilase/nitrile hydratase NIT4B isoform X1 [Amborella trichopoda] gb|ERN16213.1| hypothetical protein AMTR_s00030p00246840 [Amborella trichopoda] Length = 344 Score = 72.4 bits (176), Expect = 2e-12 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = -3 Query: 355 RAKFDFDVVGHYSRPEVLSLTVKDHPLNPVSFTSAVRAESSQK 227 RAKFDFDVVGHY+RP+VLSLTVKDHPL PVSF S ++AE +K Sbjct: 300 RAKFDFDVVGHYARPDVLSLTVKDHPLVPVSFASNIKAEGPKK 342 >ref|XP_012850391.1| PREDICTED: bifunctional nitrilase/nitrile hydratase NIT4A [Erythranthe guttata] gb|EYU26733.1| hypothetical protein MIMGU_mgv1a009205mg [Erythranthe guttata] Length = 349 Score = 72.4 bits (176), Expect = 2e-12 Identities = 36/44 (81%), Positives = 40/44 (90%), Gaps = 1/44 (2%) Frame = -3 Query: 355 RAKFDFDVVGHYSRPEVLSLTVKDHPLNPVSFTSA-VRAESSQK 227 RAKFDFDVVGHY+RPEVLSL VKD+P+ P SFTSA V+AESSQK Sbjct: 306 RAKFDFDVVGHYARPEVLSLVVKDNPMTPFSFTSASVKAESSQK 349 >gb|PKA52151.1| Bifunctional nitrilase/nitrile hydratase NIT4 [Apostasia shenzhenica] Length = 351 Score = 72.4 bits (176), Expect = 2e-12 Identities = 35/43 (81%), Positives = 36/43 (83%) Frame = -3 Query: 355 RAKFDFDVVGHYSRPEVLSLTVKDHPLNPVSFTSAVRAESSQK 227 RAKF FDVVGHYSRPEVLSLTVKDHP N VSFTSA ES +K Sbjct: 308 RAKFSFDVVGHYSRPEVLSLTVKDHPQNAVSFTSASNIESQEK 350 >ref|XP_014518652.1| bifunctional nitrilase/nitrile hydratase NIT4A [Vigna radiata var. radiata] Length = 350 Score = 72.0 bits (175), Expect = 2e-12 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -3 Query: 355 RAKFDFDVVGHYSRPEVLSLTVKDHPLNPVSFTSA 251 RAKFDFDVVGHYSRPEVLSLTVKDHP NPV+FTSA Sbjct: 307 RAKFDFDVVGHYSRPEVLSLTVKDHPTNPVTFTSA 341 >gb|KCW84883.1| hypothetical protein EUGRSUZ_B01705 [Eucalyptus grandis] Length = 146 Score = 68.9 bits (167), Expect = 3e-12 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -3 Query: 355 RAKFDFDVVGHYSRPEVLSLTVKDHPLNPVSFTS 254 RAKFDFDVVGHYSRPEVLSLTV+DHP NPV+FTS Sbjct: 103 RAKFDFDVVGHYSRPEVLSLTVRDHPSNPVNFTS 136 >gb|KCW44412.1| hypothetical protein EUGRSUZ_L02100 [Eucalyptus grandis] Length = 155 Score = 68.9 bits (167), Expect = 3e-12 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -3 Query: 355 RAKFDFDVVGHYSRPEVLSLTVKDHPLNPVSFTS 254 RAKFDFDVVGHYSRPEVLSLTV+DHP NPV+FTS Sbjct: 112 RAKFDFDVVGHYSRPEVLSLTVRDHPSNPVTFTS 145 >ref|XP_022862911.1| bifunctional nitrilase/nitrile hydratase NIT4A [Olea europaea var. sylvestris] Length = 305 Score = 70.9 bits (172), Expect = 5e-12 Identities = 35/41 (85%), Positives = 38/41 (92%), Gaps = 1/41 (2%) Frame = -3 Query: 355 RAKFDFDVVGHYSRPEVLSLTVKDHPLNPVSFTSAV-RAES 236 RAKFDFDVVGHYSRPEVLSL VKDHP++PVSFTSA +AES Sbjct: 262 RAKFDFDVVGHYSRPEVLSLVVKDHPMSPVSFTSASGKAES 302 >ref|XP_015953946.1| bifunctional nitrilase/nitrile hydratase NIT4A [Arachis duranensis] Length = 352 Score = 70.9 bits (172), Expect = 6e-12 Identities = 32/43 (74%), Positives = 34/43 (79%) Frame = -3 Query: 355 RAKFDFDVVGHYSRPEVLSLTVKDHPLNPVSFTSAVRAESSQK 227 R+KFDFDVVGHYSRPEVLSL VKDHP NPV+FTS E K Sbjct: 308 RSKFDFDVVGHYSRPEVLSLVVKDHPTNPVTFTSTTETEEKTK 350