BLASTX nr result
ID: Ophiopogon26_contig00027256
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00027256 (368 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_015577278.1| PREDICTED: uncharacterized protein LOC107261... 83 3e-16 gb|EOY01529.1| Uncharacterized protein TCM_011393 [Theobroma cacao] 83 6e-16 gb|PNX95208.1| retrovirus-related Pol polyprotein from transposo... 83 7e-16 gb|EOY04903.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) ... 82 2e-15 ref|XP_021653608.1| serine/threonine-protein phosphatase 6 regul... 80 4e-15 emb|CAN74964.1| hypothetical protein VITISV_006810 [Vitis vinifera] 80 6e-15 ref|XP_016561600.1| PREDICTED: protein RST1 isoform X3 [Capsicum... 79 1e-14 ref|XP_009758121.1| PREDICTED: zyxin-like [Nicotiana sylvestris]... 76 1e-14 gb|OWM65682.1| hypothetical protein CDL15_Pgr017179 [Punica gran... 79 2e-14 gb|ABI34342.1| Polyprotein, putative [Solanum demissum] 79 2e-14 dbj|GAU47864.1| hypothetical protein TSUD_404350 [Trifolium subt... 79 2e-14 gb|KZV29034.1| hypothetical protein F511_24005 [Dorcoceras hygro... 75 2e-14 ref|XP_009800403.1| PREDICTED: leucine-rich repeat extensin-like... 74 3e-14 gb|OIS98281.1| putative mitochondrial protein [Nicotiana attenuata] 78 3e-14 gb|KOM56592.1| hypothetical protein LR48_Vigan10g248400 [Vigna a... 73 4e-14 gb|ABI34329.1| Integrase core domain containing protein [Solanum... 78 4e-14 dbj|GAU20885.1| hypothetical protein TSUD_120770 [Trifolium subt... 77 5e-14 ref|XP_016509132.1| PREDICTED: WAS/WASL-interacting protein fami... 74 9e-14 ref|XP_021644143.1| uncharacterized protein LOC110638047 [Hevea ... 76 1e-13 ref|XP_015062884.1| PREDICTED: double-stranded RNA-binding prote... 76 2e-13 >ref|XP_015577278.1| PREDICTED: uncharacterized protein LOC107261575 [Ricinus communis] Length = 390 Score = 83.2 bits (204), Expect = 3e-16 Identities = 38/78 (48%), Positives = 56/78 (71%) Frame = -2 Query: 367 PHKTKLDPRSFKSIFLGYSRTQKGYRCFCPALNRYILTADVTFFESQPGYTLSPSAPESM 188 P DP+SFK +FLGYSR QKGY C+CP LN+Y+++ DVTFFES +++S S+ ++ Sbjct: 62 PSSVLHDPKSFKCVFLGYSRLQKGYHCYCPDLNQYLVSTDVTFFESTRFFSISLSSEQAE 121 Query: 187 DEYDYLLFRETSITSGRS 134 D+ D+L++ TSI + S Sbjct: 122 DD-DWLIYTTTSIVAADS 138 >gb|EOY01529.1| Uncharacterized protein TCM_011393 [Theobroma cacao] Length = 827 Score = 82.8 bits (203), Expect = 6e-16 Identities = 42/90 (46%), Positives = 56/90 (62%) Frame = -2 Query: 367 PHKTKLDPRSFKSIFLGYSRTQKGYRCFCPALNRYILTADVTFFESQPGYTLSPSAPESM 188 P TKLDP+S +FL YSR QKGYRC+ P LNRY+++ADVTFFE+ P ++ S S Sbjct: 410 PQVTKLDPKSLNCVFLEYSRLQKGYRCYSPTLNRYLVSADVTFFENTPFFSSSSSYDSQG 469 Query: 187 DEYDYLLFRETSITSGRSTAVTLPGKDPLR 98 +E D L++ T S +T + P P R Sbjct: 470 EEDDLLVYTVTH--SVNTTDILAPDPAPAR 497 >gb|PNX95208.1| retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Trifolium pratense] Length = 1345 Score = 82.8 bits (203), Expect = 7e-16 Identities = 44/100 (44%), Positives = 57/100 (57%), Gaps = 2/100 (2%) Frame = -2 Query: 367 PHKTKLDPRSFKSIFLGYSRTQKGYRCFCPALNRYILTADVTFFESQPGYTLSPSAPE-- 194 P K KL +S K +FLGYSR QKGYRCFCP L RYI+++DVTFFE P +++S S E Sbjct: 680 PGKDKLSAKSLKCVFLGYSRIQKGYRCFCPQLQRYIVSSDVTFFEGSPFFSVSSSPDETC 739 Query: 193 SMDEYDYLLFRETSITSGRSTAVTLPGKDPLRFREPLQVY 74 ++D+ D +P P + PLQVY Sbjct: 740 NLDDQD------------------IPSVIPTPIKPPLQVY 761 >gb|EOY04903.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8 [Theobroma cacao] Length = 781 Score = 81.6 bits (200), Expect = 2e-15 Identities = 36/67 (53%), Positives = 48/67 (71%) Frame = -2 Query: 364 HKTKLDPRSFKSIFLGYSRTQKGYRCFCPALNRYILTADVTFFESQPGYTLSPSAPESMD 185 H TKLDP+S K +FLGYSR QKGYRC+ P LNRY+++AD+TF E+ P ++ S S Sbjct: 223 HVTKLDPKSLKCVFLGYSRLQKGYRCYSPTLNRYLVSADITFLENSPFFSSSSSYDSQGK 282 Query: 184 EYDYLLF 164 E D L++ Sbjct: 283 EDDLLVY 289 >ref|XP_021653608.1| serine/threonine-protein phosphatase 6 regulatory subunit 3-like [Hevea brasiliensis] Length = 551 Score = 80.5 bits (197), Expect = 4e-15 Identities = 43/84 (51%), Positives = 54/84 (64%) Frame = -2 Query: 367 PHKTKLDPRSFKSIFLGYSRTQKGYRCFCPALNRYILTADVTFFESQPGYTLSPSAPESM 188 P +KLDP+S K +FLGYSR QKGY CF P LNRYI++ADVTFFES P ++ S E+ Sbjct: 431 PQISKLDPKSLKCVFLGYSRLQKGYMCFSPNLNRYIVSADVTFFESTPLFS-QTSMYENQ 489 Query: 187 DEYDYLLFRETSITSGRSTAVTLP 116 E D LL T +A ++P Sbjct: 490 GEEDDLLVYTTKQMQSPLSAPSVP 513 >emb|CAN74964.1| hypothetical protein VITISV_006810 [Vitis vinifera] Length = 1248 Score = 80.1 bits (196), Expect = 6e-15 Identities = 34/71 (47%), Positives = 50/71 (70%) Frame = -2 Query: 367 PHKTKLDPRSFKSIFLGYSRTQKGYRCFCPALNRYILTADVTFFESQPGYTLSPSAPESM 188 P TKLDP++ K +FLGYSR QKGYRCF P LN+Y+++ DV F E P Y+ P++ Sbjct: 643 PSVTKLDPKALKCVFLGYSRLQKGYRCFSPDLNKYVVSTDVVFSEDTPFYSSPPNSESEG 702 Query: 187 DEYDYLLFRET 155 + ++L+++ET Sbjct: 703 EGENWLIYQET 713 >ref|XP_016561600.1| PREDICTED: protein RST1 isoform X3 [Capsicum annuum] Length = 1689 Score = 79.3 bits (194), Expect = 1e-14 Identities = 35/51 (68%), Positives = 41/51 (80%) Frame = -2 Query: 367 PHKTKLDPRSFKSIFLGYSRTQKGYRCFCPALNRYILTADVTFFESQPGYT 215 P K KL PR+ K +FLGYSR QKGYRC+ P L RY+++ADVTFFESQP YT Sbjct: 40 PGKDKLAPRALKCVFLGYSRVQKGYRCYLPDLGRYLMSADVTFFESQPYYT 90 >ref|XP_009758121.1| PREDICTED: zyxin-like [Nicotiana sylvestris] ref|XP_016499496.1| PREDICTED: zyxin-like [Nicotiana tabacum] Length = 207 Score = 76.3 bits (186), Expect = 1e-14 Identities = 39/95 (41%), Positives = 58/95 (61%) Frame = -2 Query: 367 PHKTKLDPRSFKSIFLGYSRTQKGYRCFCPALNRYILTADVTFFESQPGYTLSPSAPESM 188 P K KL PR+ K IFLGYSR QKGYRC+ P L R++++ADVTFFE+Q +T + + Sbjct: 40 PRKDKLAPRALKCIFLGYSRMQKGYRCYSPNLQRFLMSADVTFFETQLYFTGPVNHLDIF 99 Query: 187 DEYDYLLFRETSITSGRSTAVTLPGKDPLRFREPL 83 + F ++ + S S+++T P P+ P+ Sbjct: 100 EVLPVPSFGDSVLISYSSSSITPPPTVPVAAPSPI 134 >gb|OWM65682.1| hypothetical protein CDL15_Pgr017179 [Punica granatum] Length = 742 Score = 78.6 bits (192), Expect = 2e-14 Identities = 35/62 (56%), Positives = 43/62 (69%) Frame = -2 Query: 367 PHKTKLDPRSFKSIFLGYSRTQKGYRCFCPALNRYILTADVTFFESQPGYTLSPSAPESM 188 P +KL PRS K +FLGY R QKGYRC+ P RY + ADVTFFES P ++ SP+ P S+ Sbjct: 220 PGSSKLSPRSLKCVFLGYLRGQKGYRCYSPEQRRYFVVADVTFFESTPFFSASPNQPPSL 279 Query: 187 DE 182 E Sbjct: 280 SE 281 >gb|ABI34342.1| Polyprotein, putative [Solanum demissum] Length = 1054 Score = 78.6 bits (192), Expect = 2e-14 Identities = 42/80 (52%), Positives = 51/80 (63%), Gaps = 5/80 (6%) Frame = -2 Query: 367 PHKTKLDPRSFKSIFLGYSRTQKGYRCFCPALNRYILTADVTFFESQPGYTLSPSAPESM 188 P K KL PR+ K +FLGYSR QKGYRC+ L+RY+++ADVTFFESQP YT S SM Sbjct: 483 PGKDKLAPRALKCVFLGYSRVQKGYRCYSHDLHRYLMSADVTFFESQPYYTSSDHPDVSM 542 Query: 187 -----DEYDYLLFRETSITS 143 F E++ITS Sbjct: 543 VLPIPQVLPVPTFEESTITS 562 >dbj|GAU47864.1| hypothetical protein TSUD_404350 [Trifolium subterraneum] Length = 1118 Score = 78.6 bits (192), Expect = 2e-14 Identities = 43/98 (43%), Positives = 55/98 (56%) Frame = -2 Query: 367 PHKTKLDPRSFKSIFLGYSRTQKGYRCFCPALNRYILTADVTFFESQPGYTLSPSAPESM 188 P K KL +S K +FLGYSR QKGYRC+ P L RYI++ADV+FFES+P + +P P Sbjct: 580 PGKDKLAAKSLKCLFLGYSRLQKGYRCYSPDLRRYIVSADVSFFESRPFFPSTPKEPNDS 639 Query: 187 DEYDYLLFRETSITSGRSTAVTLPGKDPLRFREPLQVY 74 E T V +P DP+ PL+VY Sbjct: 640 S-------LEVMTLPSAPTPVVIPTLDPIP-TPPLRVY 669 >gb|KZV29034.1| hypothetical protein F511_24005 [Dorcoceras hygrometricum] Length = 160 Score = 74.7 bits (182), Expect = 2e-14 Identities = 33/63 (52%), Positives = 47/63 (74%) Frame = -2 Query: 364 HKTKLDPRSFKSIFLGYSRTQKGYRCFCPALNRYILTADVTFFESQPGYTLSPSAPESMD 185 +++KLDP++ K++FLGYS TQKGYRC+CP + ++ DVTFFE P Y LSPS+P+ Sbjct: 69 YRSKLDPKATKTVFLGYSPTQKGYRCYCPRTKKTYISRDVTFFEDTP-YFLSPSSPKRET 127 Query: 184 EYD 176 + D Sbjct: 128 DPD 130 >ref|XP_009800403.1| PREDICTED: leucine-rich repeat extensin-like protein 2 [Nicotiana sylvestris] Length = 138 Score = 73.9 bits (180), Expect = 3e-14 Identities = 34/57 (59%), Positives = 42/57 (73%) Frame = -2 Query: 367 PHKTKLDPRSFKSIFLGYSRTQKGYRCFCPALNRYILTADVTFFESQPGYTLSPSAP 197 P K KL PR+ K +FLGYSR QKGYRC+ P L RY+++ADVTFFE+Q Y P+ P Sbjct: 40 PGKDKLAPRALKCVFLGYSRKQKGYRCYSPDLQRYLMSADVTFFETQ-SYFTGPAPP 95 >gb|OIS98281.1| putative mitochondrial protein [Nicotiana attenuata] Length = 1647 Score = 78.2 bits (191), Expect = 3e-14 Identities = 42/90 (46%), Positives = 55/90 (61%), Gaps = 2/90 (2%) Frame = -2 Query: 367 PHKTKLDPRSFKSIFLGYSRTQKGYRCFCPALNRYILTADVTFFESQPGYTLSPSAPESM 188 P K KL PR+ K +FLGYSRTQKGYRC+ P L RY+++ADVTFFE+Q +T S + Sbjct: 693 PGKDKLAPRALKCVFLGYSRTQKGYRCYSPDLRRYLMSADVTFFETQSYFT---SPGNHL 749 Query: 187 DEYDYLLFRE--TSITSGRSTAVTLPGKDP 104 D ++ L S+T S+ T P P Sbjct: 750 DIFEVLPVSSFGDSVTISHSSFSTTPAPPP 779 >gb|KOM56592.1| hypothetical protein LR48_Vigan10g248400 [Vigna angularis] Length = 120 Score = 73.2 bits (178), Expect = 4e-14 Identities = 32/62 (51%), Positives = 42/62 (67%) Frame = -2 Query: 367 PHKTKLDPRSFKSIFLGYSRTQKGYRCFCPALNRYILTADVTFFESQPGYTLSPSAPESM 188 P KL P+S K +FLGYSR QKGYRC+ P+ RY +++DVTFFE P + S P S+ Sbjct: 40 PGLDKLSPKSIKCVFLGYSRIQKGYRCYSPSTRRYYMSSDVTFFEDTPFFLSSKEYPSSV 99 Query: 187 DE 182 +E Sbjct: 100 EE 101 >gb|ABI34329.1| Integrase core domain containing protein [Solanum demissum] Length = 1775 Score = 77.8 bits (190), Expect = 4e-14 Identities = 37/60 (61%), Positives = 44/60 (73%) Frame = -2 Query: 367 PHKTKLDPRSFKSIFLGYSRTQKGYRCFCPALNRYILTADVTFFESQPGYTLSPSAPESM 188 P K KL PR+ K +FLGYSR QKGYRC+ L+RY+++ADVTFFESQP YT S SM Sbjct: 722 PGKDKLAPRALKCVFLGYSRVQKGYRCYSHDLHRYLMSADVTFFESQPYYTSSNHPDVSM 781 >dbj|GAU20885.1| hypothetical protein TSUD_120770 [Trifolium subterraneum] Length = 918 Score = 77.4 bits (189), Expect = 5e-14 Identities = 42/98 (42%), Positives = 53/98 (54%) Frame = -2 Query: 367 PHKTKLDPRSFKSIFLGYSRTQKGYRCFCPALNRYILTADVTFFESQPGYTLSPSAPESM 188 P K KL +S K IFLGYSR QKGYRCFCP L RY+++ADVTFFE+ P + S ++ Sbjct: 40 PGKDKLSAKSLKCIFLGYSRIQKGYRCFCPQLQRYLVSADVTFFETCPFFAASVPLDQNC 99 Query: 187 DEYDYLLFRETSITSGRSTAVTLPGKDPLRFREPLQVY 74 D + + V P P PL+VY Sbjct: 100 TSNDQAI----------PSVVPAPIDSPTPSPPPLRVY 127 >ref|XP_016509132.1| PREDICTED: WAS/WASL-interacting protein family member 3-like [Nicotiana tabacum] Length = 174 Score = 73.6 bits (179), Expect = 9e-14 Identities = 33/51 (64%), Positives = 41/51 (80%) Frame = -2 Query: 367 PHKTKLDPRSFKSIFLGYSRTQKGYRCFCPALNRYILTADVTFFESQPGYT 215 P K KL PR+ K IFLGYSRTQKGYRC+ P L R++++ADVTFFE+Q +T Sbjct: 40 PGKDKLAPRALKCIFLGYSRTQKGYRCYSPDLPRFLMSADVTFFETQSYFT 90 >ref|XP_021644143.1| uncharacterized protein LOC110638047 [Hevea brasiliensis] Length = 391 Score = 76.3 bits (186), Expect = 1e-13 Identities = 37/75 (49%), Positives = 48/75 (64%) Frame = -2 Query: 367 PHKTKLDPRSFKSIFLGYSRTQKGYRCFCPALNRYILTADVTFFESQPGYTLSPSAPESM 188 P TKLDP+S + +FLGYSR QKGYRCF P LN YI++A+V FFES P + S Sbjct: 40 PQVTKLDPKSLRCLFLGYSRLQKGYRCFSPTLNHYIVSANVIFFESTPFFPPSLICESLG 99 Query: 187 DEYDYLLFRETSITS 143 E D L++ ++S Sbjct: 100 KEDDLLIYSVPPVSS 114 >ref|XP_015062884.1| PREDICTED: double-stranded RNA-binding protein 1-like isoform X1 [Solanum pennellii] Length = 456 Score = 75.9 bits (185), Expect = 2e-13 Identities = 35/60 (58%), Positives = 43/60 (71%) Frame = -2 Query: 367 PHKTKLDPRSFKSIFLGYSRTQKGYRCFCPALNRYILTADVTFFESQPGYTLSPSAPESM 188 P K KL PR+ K +FLGYSR QKGYRC+ L+RY+++A +TFFESQP YT S SM Sbjct: 40 PGKDKLAPRALKCVFLGYSRVQKGYRCYSHDLHRYVMSAHITFFESQPHYTSSDHIDVSM 99